ITCH/AIP4 Antibody

Images

 
Orthogonal Strategies: Western Blot: ITCH/AIP4 Antibody [NBP2-55083] - Analysis in human cell lines Caco-2 and HEK293. Corresponding RNA-seq data are presented for the same cell lines. Loading control: ...read more
Immunocytochemistry/ Immunofluorescence: ITCH/AIP4 Antibody [NBP2-55083] - Staining of human cell line A-431 shows localization to nucleoplasm.
Western Blot: ITCH/AIP4 Antibody [NBP2-55083] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

ITCH/AIP4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GFTGASQNDDGSRSKDETRVSTNGSDDPEDAGAGENRRVSGNNSPSLSNGGFKPSRPPRPSRPPPPTPRRPASVNGS
Specificity
Specificity of human ITCH/AIP4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITCH
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
ITCH/AIP4 Knockout HeLa Cell Lysate
Control Peptide

Reactivity Notes

Rat 82%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ITCH/AIP4 Antibody

  • AIF4
  • AIP4
  • AIP4dJ468O1.1 (atrophin 1 interacting protein 4 (AIP4))
  • atrophin-1 interacting protein 4
  • Atrophin-1-interacting protein 4
  • dJ468O1.1
  • EC 6.3.2
  • EC 6.3.2.-
  • ITCH
  • itchy (mouse homolog) E3 ubiquitin protein ligase
  • itchy E3 ubiquitin protein ligase homolog (mouse)
  • itchy homolog E3 ubiquitin protein ligase
  • NAPP1
  • NAPP1E3 ubiquitin-protein ligase Itchy homolog
  • NFE2-associated polypeptide 1
  • ubiquitin protein ligase ITCH

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
NBP2-27201
Species: Hu, Mu, Rt, Eq, Pm
Applications: WB
AF1280
Species: Mu
Applications: WB, Simple Western, IHC
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
H00011059-M01
Species: Hu, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
6507-IL/CF
Species: Hu
NLS3775
Species: Hu, Mk
Applications: ICC/IF, IHC, IHC-P
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ITCH/AIP4 Antibody (NBP2-55083) (0)

There are no publications for ITCH/AIP4 Antibody (NBP2-55083).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ITCH/AIP4 Antibody (NBP2-55083) (0)

There are no reviews for ITCH/AIP4 Antibody (NBP2-55083). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ITCH/AIP4 Antibody (NBP2-55083) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ITCH/AIP4 Products

Bioinformatics Tool for ITCH/AIP4 Antibody (NBP2-55083)

Discover related pathways, diseases and genes to ITCH/AIP4 Antibody (NBP2-55083). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ITCH/AIP4 Antibody (NBP2-55083)

Discover more about diseases related to ITCH/AIP4 Antibody (NBP2-55083).
 

Pathways for ITCH/AIP4 Antibody (NBP2-55083)

View related products by pathway.

PTMs for ITCH/AIP4 Antibody (NBP2-55083)

Learn more about PTMs related to ITCH/AIP4 Antibody (NBP2-55083).

Blogs on ITCH/AIP4

There are no specific blogs for ITCH/AIP4, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ITCH/AIP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ITCH