ITCH/AIP4 Antibody - BSA Free

Immunohistochemistry-Paraffin: ITCH/AIP4 Antibody [NBP1-89180] - Staining of human duodenum shows strong positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ITCH/AIP4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ITCH/AIP4 Antibody - BSA Free (NBP1-89180) is a polyclonal antibody validated for use in IHC. Anti-ITCH/AIP4 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LKSDVLLGTAALDIYETLKSNNMKLEEVVVTLQLGGDKEPTETIGDLSICLDGLQLESEVVTNGETTCSENGVSLCLP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ITCH
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ITCH/AIP4 Recombinant Protein Antigen (NBP1-89180PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23319410)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ITCH/AIP4 Antibody - BSA Free

• AIF4
• AIP4
• AIP4dJ468O1.1 (atrophin 1 interacting protein 4 (AIP4))
• atrophin-1 interacting protein 4
• Atrophin-1-interacting protein 4
• dJ468O1.1
• EC 6.3.2
• EC 6.3.2.-
• ITCH
• itchy (mouse homolog) E3 ubiquitin protein ligase
• itchy E3 ubiquitin protein ligase homolog (mouse)
• itchy homolog E3 ubiquitin protein ligase
• NAPP1
• NAPP1E3 ubiquitin-protein ligase Itchy homolog
• NFE2-associated polypeptide 1
• ubiquitin protein ligase ITCH

Background

Atrophin-1 contains a polyglutamine repeat, expansion of which is responsible for dentatorubral and pallidoluysian atrophy. The protein encoded by this gene interacts with atrophin-1. This encoded protein is a closely related member of the NEDD4-like protein family. This family of proteins are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes. This encoded protein contains four tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. It can act as a transcriptional corepressor of p45/NFE2 and may participate in the regulation of immune responses by modifying Notch-mediated signaling. It is highly similar to the mouse Itch protein, which has been implicated in the regulation and differentiation of erythroid and lymphoid cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ITCH/AIP4 Antibody (NBP1-89180)(2)

Publications using NBP1-89180

• Li Q, Wang M, Zeng L et al. Deletion of Wild-type p53 Facilitates Bone Metastatic Function by Blocking the AIP4 Mediated Ligand-Induced Degradation of CXCR4 Frontiers in Pharmacology 2022-02-01 [PMID: 35177982]
• Bozoky B, Savchenko A, Csermely P et al. Novel signatures of cancer-associated fibroblasts. Int J Cancer 2013-07-15 [PMID: 23319410]

Bioinformatics

• Gene Symbol: ITCH