ITCH/AIP4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ITCH Antibody [NBP1-89180] Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: ITCH Antibody [NBP1-89180] - Staining of human duodenum shows strong positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ITCH/AIP4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LKSDVLLGTAALDIYETLKSNNMKLEEVVVTLQLGGDKEPTETIGDLSICLDGLQLESEVVTNGETTCSENGVSLCLP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITCH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ITCH/AIP4 Protein (NBP1-89180PEP)
Publications
Read Publication using NBP1-89180.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23319410)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ITCH/AIP4 Antibody

  • AIF4
  • AIP4
  • AIP4dJ468O1.1 (atrophin 1 interacting protein 4 (AIP4))
  • atrophin-1 interacting protein 4
  • Atrophin-1-interacting protein 4
  • dJ468O1.1
  • EC 6.3.2
  • EC 6.3.2.-
  • ITCH
  • itchy (mouse homolog) E3 ubiquitin protein ligase
  • itchy E3 ubiquitin protein ligase homolog (mouse)
  • itchy homolog E3 ubiquitin protein ligase
  • NAPP1
  • NAPP1E3 ubiquitin-protein ligase Itchy homolog
  • NFE2-associated polypeptide 1
  • ubiquitin protein ligase ITCH

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP2-27201
Species: Hu, Mu, Rt, Eq, Pm
Applications: WB
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
H00011059-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC

Publications for ITCH/AIP4 Antibody (NBP1-89180)(1)


Reviews for ITCH/AIP4 Antibody (NBP1-89180) (0)

There are no reviews for ITCH/AIP4 Antibody (NBP1-89180). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ITCH/AIP4 Antibody (NBP1-89180) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ITCH/AIP4 Products

Bioinformatics Tool for ITCH/AIP4 Antibody (NBP1-89180)

Discover related pathways, diseases and genes to ITCH/AIP4 Antibody (NBP1-89180). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ITCH/AIP4 Antibody (NBP1-89180)

Discover more about diseases related to ITCH/AIP4 Antibody (NBP1-89180).
 

Pathways for ITCH/AIP4 Antibody (NBP1-89180)

View related products by pathway.

PTMs for ITCH/AIP4 Antibody (NBP1-89180)

Learn more about PTMs related to ITCH/AIP4 Antibody (NBP1-89180).

Blogs on ITCH/AIP4

There are no specific blogs for ITCH/AIP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ITCH/AIP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ITCH
Entrez