ISM2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ISM2 Antibody [NBP1-82001] - Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: ISM2 Antibody [NBP1-82001] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ISM2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ISM2 Antibody - BSA Free (NBP1-82001) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LREEEEARLLPRTHLQAELHQHGCWTVTEPAALTPGNATPPRTQEVTPLLLELQKLPELVHATLSTPNPDNQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ISM2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ISM2 Protein (NBP1-82001PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ISM2 Antibody - BSA Free

• DKFZp686E0215
• FLJ32147
• isthmin 2 homolog (zebrafish)
• PSEC0137
• thrombospondin and AMOP domain-containing isthmin-like protein 1
• thrombospondin type-1 domain-containing protein 3
• thrombospondin, type I domain-containing 3
• THSD3
• type I, domain containing 3

Background

ISM2 is encoded by this gene contains a type 1 thrombospondin domain, which is present in thrombospondin, a number of proteins involved in the complement pathway, as well as in extracellular matrix proteins. Three alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ISM2