ISM2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ISM2 Antibody [NBP1-82001] - Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: ISM2 Antibody [NBP1-82001] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ISM2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LREEEEARLLPRTHLQAELHQHGCWTVTEPAALTPGNATPPRTQEVTPLLLELQKLPELVHATLSTPNPDNQ
Specificity
Specificity of human ISM2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ISM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ISM2 Protein (NBP1-82001PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ISM2 Antibody

  • DKFZp686E0215
  • FLJ32147
  • isthmin 2 homolog (zebrafish)
  • PSEC0137
  • thrombospondin and AMOP domain-containing isthmin-like protein 1
  • thrombospondin type-1 domain-containing protein 3
  • thrombospondin, type I domain-containing 3
  • THSD3
  • type I, domain containing 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82605
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NBP1-52193
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81978
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20460
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
NBP1-81245
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46123
Species: Hu
Applications: WB, IHC, IHC-P, IF
MAB7446
Species: Hu
Applications: Flow, CyTOF-ready
NB100-64852
Species: Hu
Applications: Flow, IHC, IHC-Fr
NB100-65853
Species: Mu
Applications: Flow, IP
AF1924
Species: Hu
Applications: WB, Simple Western, ChIP, ICC
NB300-889
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
H00388112-B01P
Species: Hu
Applications: WB, ELISA
AF1997
Species: Hu
Applications: WB, ChIP, ICC
NBP2-24583
Species: Hu, Mu, Rt, Bv, Eq, Op, Pm
Applications: WB, IHC-P
NBP1-82001
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ISM2 Antibody (NBP1-82001) (0)

There are no publications for ISM2 Antibody (NBP1-82001).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ISM2 Antibody (NBP1-82001) (0)

There are no reviews for ISM2 Antibody (NBP1-82001). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ISM2 Antibody (NBP1-82001) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ISM2 Antibody (NBP1-82001)

Discover related pathways, diseases and genes to ISM2 Antibody (NBP1-82001). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ISM2 Antibody (NBP1-82001)

Discover more about diseases related to ISM2 Antibody (NBP1-82001).
 

Pathways for ISM2 Antibody (NBP1-82001)

View related products by pathway.

PTMs for ISM2 Antibody (NBP1-82001)

Learn more about PTMs related to ISM2 Antibody (NBP1-82001).

Blogs on ISM2

There are no specific blogs for ISM2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ISM2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ISM2