Recombinant Human IRF8 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human IRF8 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 122 - 218 of Human IRF8 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFYYGGKLVGQ

Protein/Peptide Type
Partial Recombinant Protein
Gene
IRF8

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IRF8 Protein

  • ICSBP1
  • ICSBPH-ICSBP
  • interferon consensus sequence binding protein 1
  • Interferon consensus sequence-binding protein
  • interferon regulatory factor 8
  • IRF8
  • IRF-8ICSBP1

Background

IRF8 - interferon regulatory factor 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4715
Species: Mu
Applications: WB
NBP1-31207
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
AF4049
Species: Hu
Applications: WB, Simple Western
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
AF5525
Species: Hu
Applications: WB, IHC
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
AF5629
Species: Hu, Mu
Applications: WB
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB, Simple Western, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
MAB8400
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC

Publications for IRF8 Partial Recombinant Protein (H00003394-Q01) (0)

There are no publications for IRF8 Partial Recombinant Protein (H00003394-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IRF8 Partial Recombinant Protein (H00003394-Q01) (0)

There are no reviews for IRF8 Partial Recombinant Protein (H00003394-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IRF8 Partial Recombinant Protein (H00003394-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IRF8 Products

Bioinformatics Tool for IRF8 Partial Recombinant Protein (H00003394-Q01)

Discover related pathways, diseases and genes to IRF8 Partial Recombinant Protein (H00003394-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IRF8 Partial Recombinant Protein (H00003394-Q01)

Discover more about diseases related to IRF8 Partial Recombinant Protein (H00003394-Q01).
 

Pathways for IRF8 Partial Recombinant Protein (H00003394-Q01)

View related products by pathway.

PTMs for IRF8 Partial Recombinant Protein (H00003394-Q01)

Learn more about PTMs related to IRF8 Partial Recombinant Protein (H00003394-Q01).

Blogs on IRF8

There are no specific blogs for IRF8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IRF8 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IRF8
Entrez