Home » IRF7 » IRF7 Proteins » IRF7 Recombinant Protein Antigen

IRF7 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for IRF7 Protein (NBP2-38678PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

IRF7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IRF7.

Source: E.coli

Amino Acid Sequence: HPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELLRHVAPGLHLELRGPQLWARRMGKCKVYW
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IRF7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38678.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for IRF7 Recombinant Protein Antigen

  • interferon regulatory factor 7
  • interferon regulatory factor-7H
  • IRF-7
  • IRF7A
  • IRF-7H

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

IFN-alpha 1
Antibody
NBP2-75930
Western Blot: IFN-alpha 1 Antibody [NBP2-75930] - analysis of IFNA1 on mouse liver tissue lysate using anti-IFNA1 antibody at 1/100 dilution.
Immunocytochemistry/Immunofluorescence: IFN-alpha 1 Antibody [NBP2-75930] - staining IFNA1 in SH-SY5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: IFN-alpha 1 Antibody [NBP2-75930] - analysis of paraffin-embedded mouse brain tissue tissue using anti-IFNA1 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
IRF3 Antibody
(SD2062)
NBP2-67741
Western Blot: IRF3 Antibody (SD2062) [NBP2-67741] - Analysis of IRF3 on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1/500) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature. Positive control: Lane 1: Jurkat cell lysateLane 2: Hela cell lysate
Immunocytochemistry/Immunofluorescence: IRF3 Antibody (SD2062) [NBP2-67741] - Staining IRF3 in PANC-1 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: IRF3 Antibody (SD2062) [NBP2-67741] - Analysis of paraffin-embedded mouse pancreas tissue using anti-IRF3 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MuRF1/TRIM63
Antibody [Unconjugate
AF5366
Western blot shows lysates of human heart, mouse heart, and rat muscle tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat MuRF1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5366) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for MuRF1 at approximately 41‑44 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Simple Western lane view shows lysates of human heart tissue, loaded at 0.2 mg/mL. A specific band was detected for MuRF1/TRIM63 at approximately 46 kDa (as indicated) using 10 µg/mL of Goat Anti-Human/Mouse/Rat MuRF1/TRIM63 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5366) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(8 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western
TLR9 Antibody
(26C593.2)
NBP2-24729
Simple Western: TLR9 Antibody (26C593.2) [NBP2-24729] - Lane view shows a specific band for TLR9 in 0.5 mg/ml of Ramos lysate. This experiment was performed under reducing conditions using the 66-440 kDa separation system. Image using the Azide Free format of this antibody.
Flow Cytometry: TLR9 Antibody (26C593.2) [NBP2-24729] - Expression of TLR9 protein on epithelial cells. HNEC, Detroit-562 and FaDu were stained intracellularly with PE-Ab against TLR9 (open histograms) or appropriate isotype control (shaded histograms) and analyzed by flow cytometry. Representative pictures from one out of three independent experiments are shown. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0098239), licensed under a CC-BY licence.
Knockdown Validated: TLR9 Antibody (26C593.2) [NBP2-24729] - Expression of TLR-9 protein in HB cells before and after 48 hr of transfection. Beta-actin was used as an internal control. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0092748) licensed under a CC-BY licence.
(4 Reviews)
(140 Publications)
Species: Hu, Mu, Rt, Ca, Eq, Pm, Pm
Applications: WB, Simple Western, DB, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, B/N, CyTOF-ready, Flow-IC, KD
IFN-beta [Biotin]
42400-1
IFN-beta [Biotin]
(26 Publications)
Species: Mu
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(32 Reviews)
(647 Publications)
Species: Hu
TLR7 Antibody
NBP2-24906
Immunohistochemistry: TLR7 Antibody [NBP2-24906] - The expression of TLR-7 in the hippocampal brain region. The immunofluorescence of TLR7 recognized by Alexa 488, green. GFAP recognized by Alexa 594, red. NEUN recognized by Alexa 633, (blue) and merged image in the hippocampal region. NeuN and GFAP were applied to show the distribution of TLR7 within neuronal and supportive tissue populations. Scale bar 80 um. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0222818) licensed under a CC-BY licence.
Flow Cytometry: TLR7 Antibody [NBP2-24906] - An intracellular stain was performed on THP-1 cells with NBP2-24906 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5.0 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550.
Immunocytochemistry/Immunofluorescence: TLR7 Antibody [NBP2-24906] - Immunolocalization of TLR7 (A) and glial fibrillary acidic protein (GFAP) (B) in murine myenteric plexus. Most of the GFAP positive cells were also positive for TLR7 in the merged image (C, yellow staining). (Courtesy of Barajon I, et al., Journal of Histochemistry and Cytochemistry, 57(11): 1013-;1023, 2009.)
(4 Reviews)
(65 Publications)
Species: Hu, Mu, Rt
Applications: WB, DB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, BA, Flow-IC
IRF1 Antibody
(SR44-08)
NBP2-67330
Western Blot: IRF1 Antibody (SR44-08) [NBP2-67330] - Analysis of IRF1 on different lysates using anti-IRF1 antibody at 1/1,000 dilution. Positive control: Lane 1: PC-12 Lane 2: Jurkat
Immunocytochemistry/Immunofluorescence: IRF1 Antibody (SR44-08) [NBP2-67330] - Staining IRF1 in NIH/3T3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: IRF1 Antibody (SR44-08) [NBP2-67330] - Analysis of paraffin-embedded mouse brain tissue using anti-IRF1 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NFkB p50 (NLS)
Inhibitor Peptide Set
NBP2-29323
Functional (Inhibition): NFkB p105/p50 Inhibitor Peptide Set [NBP2-29323] - TLR5/NF-kB/SEAPorter HEK 293 (NBP2-26277) cells were plated in 96-well plates at 5 x 10^4 cells/well for 16 h. Cells were preincubated with different concentrations (0, 1, 5, 10, 25 and 50 uM) of Inhibitory Peptide (NBP2-29323) and Control Peptide (NBP2-29334) for 1 h. Cells were then stimulated with 1 ng/ml Flagellin (NBP2-25289) for 24 h. Secreted alkaline phosphatase (SEAP) was analyzed using SEAPorter Assay Kit (NBP2-25285). *p < 0.05 versus control peptide at the corresponding concentrations (Mann-Whitney U test).
(12 Publications)
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
STAT1 Antibody
NB100-56314
Western Blot: STAT1 Antibody [NB100-56314] - Western blot analysis of STAT1 in HeLa cell lysate using NB100-56314.
Immunocytochemistry/Immunofluorescence: STAT1 Antibody [NB100-56314] - RH30 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-STAT1 Antibody NB100-56314 at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
Immunohistochemistry-Paraffin: STAT1 Antibody [NB100-56314] - Analysis of a FFPE tissue section of human lymph node using 1:200 dilution of STAT1 antibody. The staining was developed using HRP labeled anti-rabbit secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. Strong nuclear staining in germinal center and surrounding cells along with cytoplasmic reactivity was observed.
(1 Publication)
Species: Hu, Mu, Po, Ca, Pm
Applications: WB, ICC/IF, IHC-P
IRF9 Antibody
NBP2-16991
Western Blot: IRF9 Antibody [NBP2-16991] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with IRF9 antibody diluted at 1:5000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: IRF9 Antibody [NBP2-16991] - Paraformaldehyde-fixed HeLa cells, using IRF9 antibody (Green) at 1:500 dilution. Alpha-tubulin filaments are labeled with Alpha-tubulin antibody (Red) at 1:2000.
Immunohistochemistry-Paraffin: IRF9 Antibody [NBP2-16991] - Human breast cancer, using IRF9 antibody at 1:250 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
(1 Publication)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
RIG-I Antibody
NBP2-27419
Western Blot: RIG-I Antibody [NBP2-27419] - Analysis of 293 lysate in the 1) absence and 2) presence of immunizing peptide using RIG-I antibody at 3 ug/ml. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: RIG-I Antibody [NBP2-27419] - Formalin-fixed, paraffin-embedded human breast stained with RIG-I antibody at 10 ug/ml.
Immunohistochemistry-Paraffin: RIG-I Antibody [NBP2-27419] - Formalin-fixed, paraffin-embedded human uterus stained with RIG-I antibody at 10 ug/ml.
(1 Publication)
Species: Hu, Pm
Applications: WB, IHC, IHC-P
TLR4 Antibody
(76B357.1)
NB100-56566
Dual RNAscope ISH-IHC: TLR4 Antibody (76B357.1) [NB100-56566] - FFPE tissue sections of human tonsil were probed for TLR4 mRNA (ACD RNAScope Probe, ACD catalog # 311281; Fast Red chromogen, ACD catalog # 322750). Adjacent tissue section was processed for immunohistochemistry using Mouse Monoclonal (Novus Biologicals catalog # NB100-56566) at 5ug/mL with 1 hour incubation at room temperature followed by incubation with anti-mouse IgG VisUCyte HRP Polymer Antibody (Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to lymphocytes.
Flow Cytometry: TLR4 Antibody (76B357.1) [NB100-56566] - Analysis using the Alexa Fluor (R) 647 conjugate of NBP2-27149. TLR4 expression on monocytes from human peripheral blood. PBMC were stained in a 2 color flow test, with CD14 PE version of this antibody and 1 ug of either isotype control (left) or TLR4-Alexa Fluor 647 (right). PPI negative, CD14+ cells were gated for analysis.
Immunohistochemistry: TLR4 Antibody (76B357.1) [NB100-56566] - Pericryptal Myofibroblasts are Responsible for Increased TLR4 Expression in a Subset of CRCs. Double-stained immunofluorescence for TLR4 (green) and vimentin (red) in normal (I), adenoma (II), and colon adenocarcinoma (III) (10x). In the stromal compartment of CRCs, immunofluorescent staining for TLR4 localized to the pericryptal myofibroblasts in a subset of samples. Image collected and cropped by CiteAb from the following publication (http://www.jeccr.com/content/33/1/45), licensed under a CC-BY licence.
(5 Reviews)
(101 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, B/N, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), Flow-CS, Flow-IC, KD, KO
TLR3 Antibody
(40C1285.6)
NBP2-24875
Flow Cytometry: TLR3 Antibody (40C1285.6) [NBP2-24875] - Expression of TLR3 protein on epithelial cells. HNEC (A), Detroit-562 (B) and FaDu (C) were stained intracellularly with FITC-Abs against TLR3 (open histograms) or appropriate isotype control (shaded histograms) and analyzed by flow cytometry. Representative pictures from one out of three independent experiments are shown. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0098239), licensed under a CC-BY licence.
Western Blot: TLR3 Antibody (40C1285.6) [NBP2-24875] - All the cell lines displayed a strong expression of TLR3 protein. Cell lysates were electrophoresed and blotted to PVDF membrane, which was probed with TLR3-specific antibody. To confirm the immunoreactivity of the antibody, different positive controls were included. Beta-actin was served as loading control and was used to normalize expression levels between cells. Data are representative for analysis of >=2 independent experiments. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0060671) licensed under a CC-BY licence.
Flow Cytometry: TLR3 Antibody (40C1285.6) [NBP2-24875] - Expression of TLR3 in Fravel, L363, OPM1, RPMI8226, XG1, and NCI-H929 as determined by flow cytometry. HCMLs were stained using an intracellular staining protocol with TLR3 antibodies followed by relevant secondary fluorescent-conjugated antibodies. Filled histograms (purple) represent the isotype controls and the open histograms (red) indicate TLR3. Data are representative for analysis of >=2 independent experiments. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0060671) licensed under a CC-BY licence.
(76 Publications)
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, BA, B/N, Flow-IC
IRF5 Antibody
NB100-1092
Western Blot: IRF5 Antibody [NB100-1092] - Western blot analysis of Human Spleen (A) and A549 cell lysate (B) + peptide (C), 35 ug protein in RIPA buffer. Antibody at 1 ug/mL. Detected by chemiluminescence
Western Blot: IRF5 Antibody [NB100-1092] - Endogenous IRF5 knockdown analysis. Ramos B cells were nucleofected with scrambled (Scr) or IRF5 (KD) siRNAs and lysates from same nucleofection run on multiple independent blots for comparative analysis of seven different commercially available alpha-IRF5 antibodies. Arrows indicate detection of an appropriately sized band(s) corresponding to IRF5. Data are representative of three independent experiments. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep31002), licensed under a CC-BY licence.
Western Blot: IRF5 Antibody [NB100-1092] - Comparative analysis of IRF5 protein expression between immortalized lymphoid cell lines by immunoblot. Endogenous IRF5 protein expression in lysates (T, THP-1; R, Ramos B cells; J, Jurkat T cells) was detecting by running multiple independent blots for the analysis of antibody specificity; seven different commercially available alpha-IRF5 antibodies were evaluated. IRF5 expression was detected with the previously validated Cell Signaling antibody #3257 that is no longer available. beta-actin levels and apparent molecular weight standards are shown as loading controls and for size comparison, respectively. Arrows indicate detection of an appropriately sized band(s) corresponding to IRF5. Data are representative of three independent experiments. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep31002), licensed under a CC-BY licence.
(9 Publications)
Species: Hu, Mu
Applications: WB, ChIP, Flow, PEP-ELISA
MyD88 Inhibitor
Peptide Set
NBP2-29328
MyD88 Inhibitor Peptide Set
(3 Reviews)
(86 Publications)
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
TBK1 Antibody
(108A429)
NB100-56705
Western Blot: TBK1 Antibody (108A429) [NB100-56705] - Analysis using Azide and BSA Free version of NB100-56705. Lysate from 293 cells untransfected (lane 1) and transfected with human TBK1 cDNA (lane 2) probed with TBK1 antibody at 2 ug/ml.
Immunocytochemistry/Immunofluorescence: TBK1 Antibody (108A429) [NB100-56705] - Antibody was tested in HeLa cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red). A dilution of 1:10 was used. Image objective 40x.
Immunohistochemistry-Paraffin: TBK1 Antibody (108A429) [NB100-56705] - Immunohistochemistry: TBK1 Antibody (108A429) - Azide and BSA Free [NBP2-33243] - Staining on human testis (Formalin-Fixed Paraffin-Embedded (FFPE)) Image from the Azide and BSA Free version of this antibody.
(1 Review)
(26 Publications)
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
IL-6 [HRP]
D6050
(25 Reviews)
(465 Publications)
Species: Hu
TRIF/TICAM1
Antibody
NB120-13810
Western Blot: TRIF/TICAM1 Antibody [NB120-13810] - Analysis of TRIF in mouse spleen probed with TRIF antibody, in A: presence and B: absence of immunizing peptide, at 1:1000.
Immunocytochemistry/Immunofluorescence: TRIF/TICAM1 Antibody [NB120-13810] - TRIF antibody was tested in A431 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). Image objective 40X. An antibody dilution of 1:10 was used.
Western Blot: TRIF/TICAM1 Antibody [NB120-13810] - Analysis of TRIF in mouse A: Intestine. B: Spleen. C: RAW lysate using TRIF antibody at 1:1000 dilution.
(31 Publications)
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
IRF7 Recombinant
Protein Antigen
NBP2-38678PEP
IRF7 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for IRF7 Protein (NBP2-38678PEP) (0)

There are no publications for IRF7 Protein (NBP2-38678PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IRF7 Protein (NBP2-38678PEP) (0)

There are no reviews for IRF7 Protein (NBP2-38678PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IRF7 Protein (NBP2-38678PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional IRF7 Products

Bioinformatics Tool for IRF7 Protein (NBP2-38678PEP)

Discover related pathways, diseases and genes to IRF7 Protein (NBP2-38678PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IRF7 Protein (NBP2-38678PEP)

Discover more about diseases related to IRF7 Protein (NBP2-38678PEP).
 

Pathways for IRF7 Protein (NBP2-38678PEP)

View related products by pathway.

PTMs for IRF7 Protein (NBP2-38678PEP)

Learn more about PTMs related to IRF7 Protein (NBP2-38678PEP).
 

Research Areas for IRF7 Protein (NBP2-38678PEP)

Find related products by research area.

Blogs on IRF7.

Check out the latest blog posts on IRF7.
TLR7 and Immune Response Regulation
Toll-like receptor 7 (TLR7) is a protein encoded by the TLR7 gene in humans and is a member of TLR family. TLRs controls host immune response against pathogens (e.g. viruses, bacteria and fungi) through recognition of pathogen-associated molecular pat...  Read full blog post.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
IL-6 [HRP]
IL-6 [HRP]
D6050

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IRF7 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol IRF7