IRF4 Antibody (2F2)

Images

 
Western Blot: IRF4 Antibody (2F2) [H00003662-M02] - Analysis of IRF4 expression in transfected 293T cell line by IRF4 monoclonal antibody (M02), clone 2F2.Lane 1: IRF4 transfected lysate(51.8 KDa).Lane 2: ...read more
Immunohistochemistry-Paraffin: IRF4 Antibody (2F2) [H00003662-M02] - Analysis of monoclonal antibody to IRF4 on formalin-fixed paraffin-embedded human colon. Antibody concentration 0.3 ug/ml.
Sandwich ELISA: IRF4 Antibody (2F2) [H00003662-M02] - Detection limit for recombinant GST tagged IRF4 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
2F2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IRF4 Antibody (2F2) Summary

Immunogen
IRF4 (NP_002451 342 a.a. - 451 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LCNDRPNKLERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQE
Specificity
IRF4 (2F2)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IRF4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IRF4 Antibody (2F2)

  • interferon regulatory factor 4
  • IRF4
  • IRF-4
  • LSIRF
  • LSIRFMUM1
  • Lymphocyte-specific interferon regulatory factor
  • Multiple myeloma oncogene 1
  • MUM1
  • NF-EM5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31369
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-64980
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-235
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
H00002629-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
AF3487
Species: Hu
Applications: WB, IHC, ICC
NBP2-46157
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-31207
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-64347
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq, Ft, Gt, GP, Mk, Rb
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83123
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
594-ML/CF
Species: Mu
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
H00003662-M02
Species: Hu
Applications: WB, ELISA, IHC-P

Publications for IRF4 Antibody (H00003662-M02) (0)

There are no publications for IRF4 Antibody (H00003662-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IRF4 Antibody (H00003662-M02) (0)

There are no reviews for IRF4 Antibody (H00003662-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IRF4 Antibody (H00003662-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IRF4 Products

Bioinformatics Tool for IRF4 Antibody (H00003662-M02)

Discover related pathways, diseases and genes to IRF4 Antibody (H00003662-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IRF4 Antibody (H00003662-M02)

Discover more about diseases related to IRF4 Antibody (H00003662-M02).
 

Pathways for IRF4 Antibody (H00003662-M02)

View related products by pathway.

PTMs for IRF4 Antibody (H00003662-M02)

Learn more about PTMs related to IRF4 Antibody (H00003662-M02).
 

Research Areas for IRF4 Antibody (H00003662-M02)

Find related products by research area.

Blogs on IRF4

There are no specific blogs for IRF4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IRF4 Antibody (2F2) and receive a gift card or discount.

Bioinformatics

Gene Symbol IRF4
Entrez
OMIM
Uniprot