IRF2BP1 Antibody - BSA Free

Western Blot: IRF2BP1 Antibody [NBP2-14127] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: IRF2BP1 Antibody [NBP2-14127] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells and islets of Langerhans.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IRF2BP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit IRF2BP1 Antibody - BSA Free (NBP2-14127) is a polyclonal antibody validated for use in IHC and WB. Anti-IRF2BP1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: LGSMPGLMPPGLLAAAVSGLGSRGLTLAPGLSPARPLFGSDFEKEKQQRNADCLAELNEAMRGRAEEWHGRPKAVREQL
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IRF2BP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  IRF2BP1 Protein (NBP2-14127PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for IRF2BP1 Antibody - BSA Free

• DKFZP434M154
• interferon regulatory factor 2 binding protein 1
• interferon regulatory factor 2-binding protein 1
• IRF-2-binding protein 1
• IRF2BP1
• IRF-2BP1

Background

IRF2BP1 acts as a transcriptional repressor. Acts as a transcriptional corepressor in a IRF2-dependent manner. This repression is not mediated at least in part by histone deacetylase activities

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IRF2BP1 Antibody (NBP2-14127)(1)

Publication using NBP2-14127

• Croner RS, Sturzl M, Rau T et al. Quantitative proteome profiling of lymph node positive vs. negative colorectal carcinomas pinpoints MX1 as a marker for lymph node metastasis. Int J Cancer 2014-12-15 [PMID: 24771638] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: IRF2BP1