IRF2BP1 Antibody


Western Blot: IRF2BP1 Antibody [NBP2-14127] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: IRF2BP1 Antibody [NBP2-14127] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells and islets of Langerhans.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

IRF2BP1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LGSMPGLMPPGLLAAAVSGLGSRGLTLAPGLSPARPLFGSDFEKEKQQRN ADCLAELNEAMRGRAEEWHGRPKAVREQL
Specificity of human IRF2BP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IRF2BP1 Protein (NBP2-14127PEP)
Read Publication using
NBP2-14127 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24771638).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for IRF2BP1 Antibody

  • DKFZP434M154
  • interferon regulatory factor 2 binding protein 1
  • interferon regulatory factor 2-binding protein 1
  • IRF-2-binding protein 1
  • IRF2BP1
  • IRF-2BP1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, Simple Western
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Mk
Applications: WB, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P, Single Cell Western
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for IRF2BP1 Antibody (NBP2-14127)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for IRF2BP1 Antibody (NBP2-14127) (0)

There are no reviews for IRF2BP1 Antibody (NBP2-14127). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IRF2BP1 Antibody (NBP2-14127) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional IRF2BP1 Products

Bioinformatics Tool for IRF2BP1 Antibody (NBP2-14127)

Discover related pathways, diseases and genes to IRF2BP1 Antibody (NBP2-14127). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IRF2BP1 Antibody (NBP2-14127)

Discover more about diseases related to IRF2BP1 Antibody (NBP2-14127).

Pathways for IRF2BP1 Antibody (NBP2-14127)

View related products by pathway.

PTMs for IRF2BP1 Antibody (NBP2-14127)

Learn more about PTMs related to IRF2BP1 Antibody (NBP2-14127).

Blogs on IRF2BP1

There are no specific blogs for IRF2BP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our IRF2BP1 Antibody and receive a gift card or discount.


Gene Symbol IRF2BP1