Interferon alpha 6 Antibody

Images

 
Western Blot: Interferon alpha 6 Antibody [H00003443-B01P] - analysis of IFNA6 expression in transfected 293T cell line by IFNA6 MaxPab polyclonal antibody. Lane1: IFNA6 transfected lysate (20.79 KDa). Lane2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Interferon alpha 6 Antibody Summary

Immunogen
IFNA6 (NP_066282.1, 1 a.a. - 189 a.a.) full-length human protein. MALPFALLMALVVLSCKSSCSLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKE
Specificity
IFNA6 - interferon, alpha 6,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
IFNA6
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Interferon alpha 6 Antibody

  • IFN-alpha-6
  • IFN-alphaK
  • Interferon alpha-54
  • interferon alpha-6
  • Interferon alpha-K
  • interferon, alpha 6
  • LeIF K

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003451-D01P
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-62539
Species: Hu
Applications: WB
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-42073
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Interferon alpha 6 Antibody (H00003443-B01P) (0)

There are no publications for Interferon alpha 6 Antibody (H00003443-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Interferon alpha 6 Antibody (H00003443-B01P) (0)

There are no reviews for Interferon alpha 6 Antibody (H00003443-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Interferon alpha 6 Antibody (H00003443-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Interferon alpha 6 Products

Bioinformatics Tool for Interferon alpha 6 Antibody (H00003443-B01P)

Discover related pathways, diseases and genes to Interferon alpha 6 Antibody (H00003443-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Interferon alpha 6 Antibody (H00003443-B01P)

Discover more about diseases related to Interferon alpha 6 Antibody (H00003443-B01P).
 

Pathways for Interferon alpha 6 Antibody (H00003443-B01P)

View related products by pathway.

PTMs for Interferon alpha 6 Antibody (H00003443-B01P)

Learn more about PTMs related to Interferon alpha 6 Antibody (H00003443-B01P).

Blogs on Interferon alpha 6

There are no specific blogs for Interferon alpha 6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Interferon alpha 6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFNA6
Entrez
Uniprot