Recombinant Human Integrin beta 7 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Integrin beta 7 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 401-505 of Human Integrin beta 7

Source: Wheat Germ

Amino Acid Sequence: PPGVHISYESQCEGPEKREGKAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSDTQPQAPHCSDGQGHLQCGVCSCAPG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ITGB7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
37.29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Integrin beta 7 Protein

  • Gut homing receptor beta subunit
  • integrin beta 7 subunit
  • Integrin beta 7
  • integrin beta-7
  • integrin, beta 7
  • ITGB7

Background

ITGB7 - integrin, beta 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-91258
Species: Hu, Mu, Bv, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
BBA37
Species: Hu
Applications: AdBlk
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
MAB5248
Species: Hu
Applications: IHC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1939
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
AF3827
Species: Mu
Applications: WB, Flow, CyTOF-ready
NB110-97871
Species: Mu
Applications: Flow, IHC, IHC-P, IP, CyTOF-ready
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87718
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
MAB4669
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-82633
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003695-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Integrin beta 7 Partial Recombinant Protein (H00003695-Q01) (0)

There are no publications for Integrin beta 7 Partial Recombinant Protein (H00003695-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin beta 7 Partial Recombinant Protein (H00003695-Q01) (0)

There are no reviews for Integrin beta 7 Partial Recombinant Protein (H00003695-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Integrin beta 7 Partial Recombinant Protein (H00003695-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Integrin beta 7 Products

Bioinformatics Tool for Integrin beta 7 Partial Recombinant Protein (H00003695-Q01)

Discover related pathways, diseases and genes to Integrin beta 7 Partial Recombinant Protein (H00003695-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin beta 7 Partial Recombinant Protein (H00003695-Q01)

Discover more about diseases related to Integrin beta 7 Partial Recombinant Protein (H00003695-Q01).
 

Pathways for Integrin beta 7 Partial Recombinant Protein (H00003695-Q01)

View related products by pathway.

PTMs for Integrin beta 7 Partial Recombinant Protein (H00003695-Q01)

Learn more about PTMs related to Integrin beta 7 Partial Recombinant Protein (H00003695-Q01).
 

Research Areas for Integrin beta 7 Partial Recombinant Protein (H00003695-Q01)

Find related products by research area.

Blogs on Integrin beta 7

There are no specific blogs for Integrin beta 7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Integrin beta 7 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGB7
Entrez