Integrin alpha E/CD103 Recombinant Protein Antigen

Images

 
There are currently no images for Integrin alpha E/CD103 Protein (NBP1-88142PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Integrin alpha E/CD103 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ITGAE.

Source: E. coli

Amino Acid Sequence: CEEDCFSNASVKVSYQLQTPEGQTDHPQPILDRYTEPFAIFQLPYEKACKNKLFCVAELQLATTVSQQELVVGLTKELTLN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ITGAE
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88142.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Integrin alpha E/CD103 Recombinant Protein Antigen

  • antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide
  • CD103 antigen
  • CD103
  • HML-1 antigen
  • HUMINAE
  • Integrin alpha E
  • integrin alpha-E
  • Integrin alpha-IEL
  • integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alphapolypeptide)
  • ITGAE
  • MGC141996
  • Mucosal lymphocyte 1 antigen

Background

CD103 is a member of the integrin series of adhesion molecules. This antigen defines a developmentally important subset of T cells, namely mucosal T cells including all IEL (intraepithelial lymphocytes) and approx. 20% of lamina propria T cells. Expression of CD103 is more restricted outside these mucosal organs, appearing at lower levels on T cell subsets of the lymph node, dendritic epidermis and periphery. In non-epithelial CD103+ T cells there is a bias toward expression on CD8+.cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
DR2A00
Species: Hu
Applications: ELISA
NBP2-16996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB100-39002
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC,  IHC-P, IP, Single-Cell Western, WB
NB110-97871
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
DY417
Species: Mu
Applications: ELISA
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, ISH, Simple Western, Single-Cell Western, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
MAB4841
Species: Mu
Applications: CompCytotox, CyTOF-ready, Flow, ICC, IHC, IP, Tstim
6507-IL/CF
Species: Hu
Applications: BA
BBA24
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-44634
Species: Bv, Hu
Applications: CyTOF-ready, Flow, IP
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB

Publications for Integrin alpha E/CD103 Protein (NBP1-88142PEP) (0)

There are no publications for Integrin alpha E/CD103 Protein (NBP1-88142PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin alpha E/CD103 Protein (NBP1-88142PEP) (0)

There are no reviews for Integrin alpha E/CD103 Protein (NBP1-88142PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Integrin alpha E/CD103 Protein (NBP1-88142PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Integrin alpha E/CD103 Products

Research Areas for Integrin alpha E/CD103 Protein (NBP1-88142PEP)

Find related products by research area.

Blogs on Integrin alpha E/CD103

There are no specific blogs for Integrin alpha E/CD103, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Integrin alpha E/CD103 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGAE