Integrin alpha E/CD103 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Integrin alpha E/CD103 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ITGAE.
  
  

  Source: E. coli

  Amino Acid Sequence: CEEDCFSNASVKVSYQLQTPEGQTDHPQPILDRYTEPFAIFQLPYEKACKNKLFCVAELQLATTVSQQELVVGLTKELTLN

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: ITGAE
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88142.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Integrin alpha E/CD103 Recombinant Protein Antigen

• antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide
• CD103 antigen
• CD103
• HML-1 antigen
• HUMINAE
• Integrin alpha E
• integrin alpha-E
• Integrin alpha-IEL
• integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alphapolypeptide)
• ITGAE
• MGC141996
• Mucosal lymphocyte 1 antigen

Background

CD103 is a member of the integrin series of adhesion molecules. This antigen defines a developmentally important subset of T cells, namely mucosal T cells including all IEL (intraepithelial lymphocytes) and approx. 20% of lamina propria T cells. Expression of CD103 is more restricted outside these mucosal organs, appearing at lower levels on T cell subsets of the lymph node, dendritic epidermis and periphery. In non-epithelial CD103+ T cells there is a bias toward expression on CD8+.cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: ITGAE