Integrin alpha 2/CD49b Antibody (7O9H6)

Western Blot: Integrin alpha 2/CD49b Antibody (7O9H6) [NBP3-15644] - Analysis of extracts of various cell lines, using Integrin alpha 2/CD49b (ITGA2/CD49b) antibody (NBP3-15644) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Western Blot: Integrin alpha 2/CD49b Antibody (7O9H6) [NBP3-15644] - Analysis of lysates from A549 cells, using [KO Validated] Integrin alpha 2 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 1s.

Immunohistochemistry: Integrin alpha 2/CD49b Antibody (7O9H6) [Integrin alpha 2/CD49b] - Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using [KO Validated] Integrin alpha 2/CD49b Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Integrin alpha 2/CD49b Antibody (7O9H6) [Integrin alpha 2/CD49b] - Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using [KO Validated] Integrin alpha 2/CD49b Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Integrin alpha 2/CD49b Antibody (7O9H6) [Integrin alpha 2/CD49b] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using [KO Validated] Integrin alpha 2/CD49b Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Integrin alpha 2/CD49b Antibody (7O9H6) [Integrin alpha 2/CD49b] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using [KO Validated] Integrin alpha 2/CD49b Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Integrin alpha 2/CD49b Antibody (7O9H6) [Integrin alpha 2/CD49b] - Immunohistochemistry analysis of paraffin-embedded Human breast tissue using [KO Validated] Integrin alpha 2/CD49b Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Integrin alpha 2/CD49b Antibody (7O9H6) [Integrin alpha 2/CD49b] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using [KO Validated] Integrin alpha 2/CD49b Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC, KO
• Clone: 7O9H6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Integrin alpha 2/CD49b Antibody (7O9H6) Summary

• Description: Novus Biologicals Knockout (KO) Validated Rabbit Integrin alpha 2/CD49b Antibody (7O9H6) (NBP3-15644) is a recombinant monoclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1082-1181 of human Integrin alpha 2/CD49b (P17301). GTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDEKAEVPTGVIIGSIIAGILLLLALVAILWKLGFFKRKYEKMTKNPDEIDETTELSS
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: ITGA2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunohistochemistry 1:200 - 1:800
  • Immunohistochemistry-Paraffin 1:200 - 1:800
  • Knockout Validated
  • Western Blot 1:1000 - 1:6000
• Theoretical MW: 129 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Integrin alpha 2/CD49b Antibody (7O9H6)

• alpha-2 subunit
• CD49b antigen
• CD49b
• Integrin alpha 2
• integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor)
• ITGA2
• VLA 2
• VLA-2 alpha

Background

Integrins are heterodimeric cell surface receptors composed of alpha and beta subunits, which mediate cell-cell and cell-extracellular matrix attachments. They are responsible for adhesion of platelets and other cells to collagens, modulation of collagen and collagenase gene expression, force generation and organization of newly synthesized extracellular matrix. Aberrant integrin expression has been found in many epithelial tumours. Changes in integrin expression have been shown to be important for the growth and early metastatic capacity of melanoma cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ITGA2