INSL4 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: INSL4 Antibody [NBP3-17385] - Staining of human cell line A549 shows localization to vesicles.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

INSL4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit INSL4 Antibody - BSA Free (NBP3-17385) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AAELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVSTSNNKDGQALGT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: INSL4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for INSL4 Antibody - BSA Free

• early placenta insulin-like peptide
• EPIL
• EPILearly placenta insulin-like peptide (EPIL)
• INSL4
• insulin-like 4 (placenta)
• Insulin-like peptide 4
• Placentin

Background

Insulin is a secreted peptide hormone that elicits metabolic effects such as increases in glucose uptake and glycogen synthesis leading to a decrease in blood glucose concentration. Insulin is first formed as a precursor molecule, preproinsulin, which is later cleaved to proinsulin and finally to the mature insulin hormone. Insulin-like peptides (INSL proteins), also designated Relaxinlike factors, are members of the insulin family, which regulate cell growth, metabolism and tissue-specific functions. INSL1-7 are mostly secreted proteins that are expressed mainly in testis, placenta, uterus or prenatal tissues. INSL4 is a 139 amino acid secreted protein expressed in the placenta, uterus and in fetal perichondrium. It may play an important role in the regulation of bone formation and in trophoblast development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: INSL4