ING2 Antibody

Immunocytochemistry/Immunofluorescence: ING2 Antibody [NBP3-05514] - Staining of human cell line U-251 MG shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: ING2 Antibody [NBP3-05514] - Analysis in human testis and pancreas tissues using Anti-ING2 antibody. Corresponding ING2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ING2 Antibody [NBP3-05514] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: ING2 Antibody [NBP3-05514] - Staining of human testis shows high expression.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ING2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TQMLELVENRARQMELHSQCFQDPAESERASDKAKMDSSQPERSSRRPRRQRTSESRDLCHMANGIEDCDDQPPKEKKSKSAKK
• Predicted Species: Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ING2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF fixation permeabilization use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, containing 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ING2 Antibody

• ING1Linhibitor of growth family, member 1-like
• ING1Lp
• Inhibitor of growth 1-like protein
• inhibitor of growth family, member 2
• inhibitor of growth protein 2
• p33ING2p32

Background

ING2 is similar to ING1, a tumor suppressor protein that can bind TP53, inhibit cell growth, and induce apoptosis. This protein binds phosphoinositides (PtdInPs) at its plant homeodomain (PHD) domain and it acts as a PtdInPs receptor. PtdInPs binding regulates the ability of this protein to activate TP53 and TP53-dependent apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ING2