ING1 Recombinant Protein Antigen

Images

 
There are currently no images for ING1 Recombinant Protein Antigen (NBP2-57223PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ING1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ING1.

Source: E. coli

Amino Acid Sequence: VELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ING1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57223.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ING1 Recombinant Protein Antigen

  • growth inhibitor ING1
  • growth inhibitory protein ING1
  • ING1
  • inhibitor of growth family, member 1
  • inhibitor of growth protein 1
  • p24ING1c
  • p33
  • p33ING1
  • p33ING1b
  • p47
  • p47ING1a
  • tumor suppressor ING1

Background

p33 ING1 is a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53-signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. The accession number listed below is for variant (4) that encodes the longest isoform (D). Other synonyms for p33 ING1 include p33, p47, p33ING1, p24ING1c, p33ING1b, p47ING1a, growth inhibitor ING1, inhibitor of growth 1, tumor suppressor ING1 and growth inhibitory protein ING1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-790
Species: Ba, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, PEP-ELISA, WB
NBP2-22377
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-05513
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF5675
Species: Hu, Mu, Rt
Applications: IHC, IP, KO, WB
NBP2-41291
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-33736
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-13754
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-46613
Species: Hu, Mu, Rt, Ze
Applications: ELISA, ICC/IF, IHC, WB
NBP1-52105
Species: Hu, Rt
Applications: Flow, IHC,  IHC-P, PEP-ELISA, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF1916
Species: Hu
Applications: ICC, IHC, WB
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, WB
NBP2-79854
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP2-38780
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84022
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-57223PEP
Species: Hu
Applications: AC

Publications for ING1 Recombinant Protein Antigen (NBP2-57223PEP) (0)

There are no publications for ING1 Recombinant Protein Antigen (NBP2-57223PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ING1 Recombinant Protein Antigen (NBP2-57223PEP) (0)

There are no reviews for ING1 Recombinant Protein Antigen (NBP2-57223PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ING1 Recombinant Protein Antigen (NBP2-57223PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ING1 Products

Research Areas for ING1 Recombinant Protein Antigen (NBP2-57223PEP)

Find related products by research area.

Blogs on ING1.

Understanding the Reasons for Histone H3 K4 Trimethylation (H3K4Me3)
Epigenetic mechanisms allow distinction between the active and inactive compartments of the genome, allowing proper cell lineage and embryogenesis. The trimethylation of Histone 3 at lysine 4 (H3K4Me3) is a common epigenetic histone modification that ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ING1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ING1