INCENP Recombinant Protein Antigen

Images

 
There are currently no images for INCENP Recombinant Protein Antigen (NBP2-57266PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

INCENP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human INCENP.

Source: E.coli

Amino Acid Sequence: IICHSYLERLLNVEVPQKVGSEQKEPPEEAEPVAAAEPEVPENNGNNSWPHNDTEIANSTPNPKPAASSPETPSAGQQEAKTDQADGP

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
INCENP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-57266 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for INCENP Recombinant Protein Antigen

  • binds and activates aurora-B and -C in vivo and in vitro
  • chromosomal passenger protein
  • FLJ31633
  • inner centromere protein antigens (135kD, 155kD)
  • inner centromere protein antigens 135/155kDa
  • inner centromere protein INCENP
  • inner centromere protein
  • MGC111393

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-294
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, MiAr
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89951
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, MiAr
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55474
Species: Hu
Applications: ICC/IF
NBP2-17299
Species: Hu
Applications: WB, ICC/IF
NB100-353
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-20053
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-82875
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47663
Species: Hu
Applications: WB, IHC, IHC-P
NB100-563
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-01064
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-7325
Species: Bv
Applications: WB, ELISA, IHC, IHC-P
NBP1-06579
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-57266PEP
Species: Hu
Applications: AC

Publications for INCENP Recombinant Protein Antigen (NBP2-57266PEP) (0)

There are no publications for INCENP Recombinant Protein Antigen (NBP2-57266PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for INCENP Recombinant Protein Antigen (NBP2-57266PEP) (0)

There are no reviews for INCENP Recombinant Protein Antigen (NBP2-57266PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for INCENP Recombinant Protein Antigen (NBP2-57266PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Array NBP2-57266PEP

Bioinformatics Tool for INCENP Recombinant Protein Antigen (NBP2-57266PEP)

Discover related pathways, diseases and genes to INCENP Recombinant Protein Antigen (NBP2-57266PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for INCENP Recombinant Protein Antigen (NBP2-57266PEP)

Discover more about diseases related to INCENP Recombinant Protein Antigen (NBP2-57266PEP).
 

Pathways for INCENP Recombinant Protein Antigen (NBP2-57266PEP)

View related products by pathway.

PTMs for INCENP Recombinant Protein Antigen (NBP2-57266PEP)

Learn more about PTMs related to INCENP Recombinant Protein Antigen (NBP2-57266PEP).
 

Research Areas for INCENP Recombinant Protein Antigen (NBP2-57266PEP)

Find related products by research area.

Blogs on INCENP

There are no specific blogs for INCENP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our INCENP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol INCENP