Importin4 Antibody

Images

 
Immunohistochemistry-Paraffin: Importin4 Antibody [NBP1-89841] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Importin4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AFLPYMESVFEEVFKLLECPHLNVRKAAHEALGQFCCALHKACQSCPSEPNTAALQAALARVVPSYMQAVNRERERQVVMAVLE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IPO4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Importin4 Protein (NBP1-89841PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Importin4 Antibody

  • IMP4B
  • importin 4
  • importin-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-59475
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-84339
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87512
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56484
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
NBP1-87835
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-17262
Species: Hu
Applications: WB, ICC/IF
NB110-85519
Species: Hu, Mu
Applications: WB, ELISA, IHC, IP
NBP1-88525
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83966
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33286
Species: Hu
Applications: IHC, IHC-P
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82269
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-430
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00003250-B01P-50ug
Species: Hu
Applications: WB
NBP1-89841
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Importin4 Antibody (NBP1-89841) (0)

There are no publications for Importin4 Antibody (NBP1-89841).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Importin4 Antibody (NBP1-89841) (0)

There are no reviews for Importin4 Antibody (NBP1-89841). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Importin4 Antibody (NBP1-89841) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Importin4 Products

Bioinformatics Tool for Importin4 Antibody (NBP1-89841)

Discover related pathways, diseases and genes to Importin4 Antibody (NBP1-89841). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Importin4 Antibody (NBP1-89841)

Discover more about diseases related to Importin4 Antibody (NBP1-89841).
 

Pathways for Importin4 Antibody (NBP1-89841)

View related products by pathway.

Blogs on Importin4

There are no specific blogs for Importin4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Importin4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IPO4