PPAN Antibody


Western Blot: PPAN Antibody [NBP1-88525] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: PPAN Antibody [NBP1-88525] - Staining of human oral mucosa shows strong nucleolar positivity in squamous epithelial cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

PPAN Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:RWEMDRGRGRLCDQKFPKTKDKSQGAQARRGPRGASRDGG
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PPAN Protein (NBP1-88525PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PPAN Antibody

  • Brix domain-containing protein 3
  • homolog of S. cerevisiae SSF1
  • MGC14226
  • MGC45852
  • peter pan (Drosophila) homolog
  • peter pan homolog (Drosophila)
  • Peter Pan homolog
  • second-step splicing factor 1
  • SSF
  • Ssf-1
  • SSF2
  • suppressor of sterile four 1
  • suppressor of SWI4 1 homolog


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PPAN Antibody (NBP1-88525) (0)

There are no publications for PPAN Antibody (NBP1-88525).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPAN Antibody (NBP1-88525) (0)

There are no reviews for PPAN Antibody (NBP1-88525). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPAN Antibody (NBP1-88525) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PPAN Products

Bioinformatics Tool for PPAN Antibody (NBP1-88525)

Discover related pathways, diseases and genes to PPAN Antibody (NBP1-88525). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPAN Antibody (NBP1-88525)

Discover more about diseases related to PPAN Antibody (NBP1-88525).

Pathways for PPAN Antibody (NBP1-88525)

View related products by pathway.

PTMs for PPAN Antibody (NBP1-88525)

Learn more about PTMs related to PPAN Antibody (NBP1-88525).

Blogs on PPAN

There are no specific blogs for PPAN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PPAN Antibody and receive a gift card or discount.


Gene Symbol PPAN