Importin-9 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of human Importin-9. Peptide sequence: ILKLIINELSNVMEANAARQATPAEWSQDDSNDMWEDQEEEEEEEEDGLA The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
IPO9 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Importin-9 Antibody - BSA Free
Background
Official Gene Symbol: IPO9 Gene ID: 55705 (Human) Gene Map Locus: 1q32.1 (Human) Importin 9 is a novel member of highly conserved Karyopherin Super family. Karyopherins are transport receptors consisting of an N-terminal RanGTP-binding motif and mediate the transport of protein and RNA across the nucleus and cytoplasm. These proteins interact directly with nuclear pore complex and shuttle continuously between the nucleus and cytoplasm. Importin-9 is a RAN-GTP binding protein and mediates the nuclear import of individual core histones and TBP. Reports suggest Importin-9 also interacts with subunits of PP2A (protein phosphatase 2A) and aids in nuclear import.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu, Mu
Applications: CyTOF-ready, IHC, ICFlow, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IHC, KO, Simple Western, WB
Species: Am, Bv, Ca, Ch, Fi, Gp, Hu, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Publications for Importin-9 Antibody (NBP2-86678) (0)
There are no publications for Importin-9 Antibody (NBP2-86678).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Importin-9 Antibody (NBP2-86678) (0)
There are no reviews for Importin-9 Antibody (NBP2-86678).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Importin-9 Antibody (NBP2-86678) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Importin-9 Products
Research Areas for Importin-9 Antibody (NBP2-86678)
Find related products by research area.
|
Blogs on Importin-9