ILT7/CD85g/LILRA4 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

ILT7/CD85g/LILRA4 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ILT7/CD85g/LILRA4.
  
  

  Source: E. coli

  Amino Acid Sequence: DHRLSWTLNSHQHNHGKFQALFPMGPLTFSNRGTFRCYGYENNTPYVWSEPSD

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: LILRA4
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48932.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 24 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ILT7/CD85g/LILRA4 Recombinant Protein Antigen

• CD85 antigen-like family member G
• CD85g antigen
• CD85g
• ILT7
• ILT-7
• ILT7MGC129598
• Immunoglobulin-like transcript 7
• leukocyte immunoglobulin-like receptor subfamily A member 4
• leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 4
• leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member4
• LILRA4
• MGC129597

Background

ILT7 (immunoglobulin-like transcript 7) is a member of leukocyte immunoglobulin-like receptor (LIR or LILR) gene family, also known as CD85g and LILRA4. It contains four extracellular Ig domains. In association with Fc epsilonR1 gamma, ILT7 forms a receptor complex that transduces ITAM-mediated signals. ILT7 is specifically expressed on plasmacytoid dendritic cells (pDCs), but not on myeloid dendritic cells and other peripheral blood leukocytes. ILT7 negatively regulates the innate immune functions of human pDCs. Cross-linking 17G10.2 antibody is able to trigger ILT7 mediated signaling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: LILRA4