ILT5/CD85a/LILRB3 Antibody - BSA Free

Staining of human cell line HaCaT shows localization to plasma membrane.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ILT5/CD85a/LILRB3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ILT5/CD85a/LILRB3 Antibody - BSA Free (NBP3-24915) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein ILT5/CD85a/LILRB3 using the following amino acid sequence: CHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LILRB3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ILT5/CD85a/LILRB3 Antibody - BSA Free

• CD85 antigen-like family member A
• CD85a antigen
• CD85a
• HL9Immunoglobulin-like transcript 5
• ILT5
• ILT-5
• ILT5CD85a
• Leukocyte immunoglobulin-like receptor 3
• leukocyte immunoglobulin-like receptor subfamily B member 3
• leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains)
• LILRB3
• LIR3
• LIR3CD85A
• LIR-3MGC138403
• member 3
• Monocyte inhibitory receptor HL9
• PIRB

Background

LILRB3 is a 631 amino acid type I transmembrane glycoprotein, which contains four immunoreceptor tyrosine-based inhibition motif (ITIM) sequences within a long cytoplasmic tail. Phosphorylation of the tyrosine residues within ITIMs is known to enable the binding and activation of protein tyrosine phosphatases, which act as cell signaling modulators and inhibitors of cell activation. LILRB3 may act as receptor for class I MHC antigens.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LILRB3