ILT5/CD85a/LILRB3 Antibody - BSA Free Summary
| Immunogen |
This antibody has been engineered to specifically recognize the recombinant protein ILT5/CD85a/LILRB3 using the following amino acid sequence: CHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
LILRB3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
|
| Application Notes |
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for ILT5/CD85a/LILRB3 Antibody - BSA Free
Background
LILRB3 is a 631 amino acid type I transmembrane glycoprotein, which contains four immunoreceptor tyrosine-based inhibition motif (ITIM) sequences within a long cytoplasmic tail. Phosphorylation of the tyrosine residues within ITIMs is known to enable the binding and activation of protein tyrosine phosphatases, which act as cell signaling modulators and inhibitors of cell activation. LILRB3 may act as receptor for class I MHC antigens.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: CyTOF-reported, Neut, WB
Species: Mu
Applications: WB
Species: Rt
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, Simple Western, WB
Publications for ILT5/CD85a/LILRB3 Antibody (NBP3-24915) (0)
There are no publications for ILT5/CD85a/LILRB3 Antibody (NBP3-24915).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ILT5/CD85a/LILRB3 Antibody (NBP3-24915) (0)
There are no reviews for ILT5/CD85a/LILRB3 Antibody (NBP3-24915).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ILT5/CD85a/LILRB3 Antibody (NBP3-24915) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ILT5/CD85a/LILRB3 Products
Blogs on ILT5/CD85a/LILRB3