IL6R Antibody

Western Blot: IL6R Antibody [H00003570-B01P] - Analysis of IL6R expression in HeLa.

Flow Cytometry: IL6R Antibody [H00003570-B01P] - Analysis of negative control 293 cells (Black) and IL6R expressing 293 cells (Green) using IL6R purified mouse polyclonal antibody.

Western Blot: IL6R Antibody [H00003570-B01P] - Analysis of IL6R expression in transfected 293T cell line by IL6R polyclonal antibody. Lane 1: IL6R transfected lysate(51.48 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

IL6R Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: IL6R (NP_000556.1, 1 a.a. - 468 a.a.) full-length human protein. MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
• Specificity: Reacts with interleukin 6 receptor.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: IL6R
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Flow Cytometry
  • Western Blot
• Application Notes: This antibody is reactive against transfected lysate in WB, FACS analysis and as a detection antibody in ELISA. It has been use for FACS.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IL6R Antibody

• CD126 antigen
• CD126
• gp80
• IL-6 receptor subunit alpha
• IL-6R 1
• IL-6R subunit alpha
• IL-6R-1
• IL6RA
• IL-6RA
• IL-6R-alpha
• interleukin 6 receptor alpha subunit
• interleukin 6 receptor
• interleukin-6 receptor subunit alpha
• Membrane glycoprotein 80
• MGC104991

Background

Interleukin 6 (IL6) is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in immune response. The protein encoded by this gene is a subunit of the receptor complex for IL6. The IL6 receptor is a protein complex consisting of this protein and interleukin 6 signal transducer (IL6ST/GP130/IL6-beta), a receptor subunit also shared by many other cytokines. Dysregulated production of IL6 and this receptor are implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IL6R
• Entrez:
  • 3570(Human)
• Uniprot:
  • NP_000556.1(Human)