IL6R Antibody (2G6)

Images

 
Sandwich ELISA: IL6R Antibody (2G6) [H00003570-M01] - Detection limit for recombinant GST tagged IL6R is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2G6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IL6R Antibody (2G6) Summary

Immunogen
IL6R (NP_000556, 21 a.a. - 120 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. APRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLS
Specificity
IL6R - interleukin 6 receptor
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IL6R
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IL6R Antibody (2G6)

  • CD126 antigen
  • CD126
  • gp80
  • IL-6 receptor subunit alpha
  • IL-6R 1
  • IL-6R subunit alpha
  • IL-6R-1
  • IL6RA
  • IL-6RA
  • IL-6R-alpha
  • interleukin 6 receptor alpha subunit
  • interleukin 6 receptor
  • interleukin-6 receptor subunit alpha
  • Membrane glycoprotein 80
  • MGC104991

Background

Interleukin 6 (IL6) is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in immune response. The protein encoded by this gene is a subunit of the receptor complex for IL6. The IL6 receptor is a protein complex consisting of this protein and interleukin 6 signal transducer (IL6ST/GP130/IL6-beta), a receptor subunit also shared by many other cytokines. Dysregulated production of IL6 and this receptor are implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32744
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00003570-M01
Species: Hu
Applications: WB, ELISA

Publications for IL6R Antibody (H00003570-M01) (0)

There are no publications for IL6R Antibody (H00003570-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL6R Antibody (H00003570-M01) (0)

There are no reviews for IL6R Antibody (H00003570-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL6R Antibody (H00003570-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IL6R Products

Bioinformatics Tool for IL6R Antibody (H00003570-M01)

Discover related pathways, diseases and genes to IL6R Antibody (H00003570-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL6R Antibody (H00003570-M01)

Discover more about diseases related to IL6R Antibody (H00003570-M01).
 

Pathways for IL6R Antibody (H00003570-M01)

View related products by pathway.

PTMs for IL6R Antibody (H00003570-M01)

Learn more about PTMs related to IL6R Antibody (H00003570-M01).
 

Research Areas for IL6R Antibody (H00003570-M01)

Find related products by research area.

Blogs on IL6R

There are no specific blogs for IL6R, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL6R Antibody (2G6) and receive a gift card or discount.

Bioinformatics

Gene Symbol IL6R
Entrez
OMIM
Uniprot