IL-4R alpha Recombinant Protein Antigen

Images

 
There are currently no images for IL-4R alpha Recombinant Protein Antigen (NBP3-21332PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IL-4R alpha Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL-4R alpha

Source: E.coli

Amino Acid Sequence: DNLTCTETPLVIAGNPAYRSFSNSLSQSPCPRELGPDPLLARHLEEVEPEMPCVPQLSEPTTVPQPEPETWEQILRRNVLQHGAAAAPVSAPTSGYQEFV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IL4R
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21332. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IL-4R alpha Recombinant Protein Antigen

  • CD124 antigen
  • CD124
  • IL-4 R alpha
  • IL-4 receptor subunit alpha
  • IL4R alpha
  • IL-4R alpha
  • IL-4R subunit alpha
  • IL4R
  • IL-4Ra
  • IL4RACD124
  • IL-4R-alpha
  • interleukin 4 receptor
  • interleukin-4 receptor alpha chain
  • interleukin-4 receptor subunit alpha

Background

IL4 is a pleiotropic cytokine produced by activated T cells, mast cells and basophils. It is a ligand for Interleukin 4 receptor. The Interleukin 4 receptor also binds to IL13, which may contribute to many overlapping functions of this cytokine and IL13. IL4 elicits many different biological responses, but has two dominant functions. The first is regulating differentiation of na ve CD4+ T cell to the Th2 type. Th2 cells produce IL4, IL5, IL10 and IL13, which tend to favor a humoral immune response while suppressing a cell mediated immune response controlled by Th1 cells. STAT6, a signal transducer and activator of transcription, has been shown to play a central role in mediating the immune regulatory signal of this cytokine. The second is regulating IgE and IgG1 production by B cells. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

6507-IL/CF
Species: Hu
Applications: BA
DY413
Species: Mu
Applications: ELISA
DY417
Species: Mu
Applications: ELISA
202-IL
Species: Hu
Applications: BA
NBP2-25241
Species: Hu, Mu
Applications: ICC/IF, IP, WB
M6000B
Species: Mu
Applications: ELISA
7268-CT
Species: Hu
Applications: BA
NBP3-11412
Species: Sh
Applications: ELISA, IHC, IHC-Fr, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
AF152
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
DR2A00
Species: Hu
Applications: ELISA
AF146
Species: Hu
Applications: Block, CyTOF-ready, Flow, IHC, Simple Western, WB
DRA00B
Species: Hu
Applications: ELISA
M5000
Species: Mu
Applications: ELISA
NBP2-93743
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
DC140
Species: Hu
Applications: ELISA

Publications for IL-4R alpha Recombinant Protein Antigen (NBP3-21332PEP) (0)

There are no publications for IL-4R alpha Recombinant Protein Antigen (NBP3-21332PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-4R alpha Recombinant Protein Antigen (NBP3-21332PEP) (0)

There are no reviews for IL-4R alpha Recombinant Protein Antigen (NBP3-21332PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IL-4R alpha Recombinant Protein Antigen (NBP3-21332PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IL-4R alpha Products

Research Areas for IL-4R alpha Recombinant Protein Antigen (NBP3-21332PEP)

Find related products by research area.

Blogs on IL-4R alpha

There are no specific blogs for IL-4R alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IL-4R alpha Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IL4R