IL-36 gamma/IL-1F9 Antibody - BSA Free

Staining of human cell line HaCaT shows localization to plasma membrane.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IL-36 gamma/IL-1F9 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit IL-36 gamma/IL-1F9 Antibody - BSA Free (NBP3-24913) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein IL-36 gamma/IL-1F9 using the following amino acid sequence: AFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IL36G
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for IL-36 gamma/IL-1F9 Antibody - BSA Free

• IL-1 epsilon
• IL-1 H1
• IL-1 Related Protein 2
• IL-1(EPSILON)
• IL1E
• IL-1-epsilon
• IL1F9
• IL-1F9
• IL1H1
• IL-1H1
• IL-1-Related Protein 2
• IL1RP2
• IL-1rp2
• IL36 gamma
• IL-36 gamma
• IL36G
• interleukin 1 family, member 9
• interleukin 1-related protein 2
• Interleukin 36, Gamma
• Interleukin-1 epsilon
• interleukin-1 family member 9
• Interleukin-1 homolog 1
• Interleukin-36 Gamma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IL36G