IL-22BP/IL22 RA2 Antibody - BSA Free

Western Blot: IL-22BP/IL22 RA2 Antibody [NBP1-85455] - Analysis in control (vector only transfected HEK293T lysate) and IL22RA2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: IL-22BP/IL22 RA2 Antibody [NBP1-85455] - Staining of human kidney shows moderate cytoplasmic staining and luminal membrane positivity in tubules.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IL-22BP/IL22 RA2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IL22RA2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  IL-22BP/IL22 RA2 Protein (NBP1-85455PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for IL-22BP/IL22 RA2 Antibody - BSA Free

• class II cytokine receptor
• CRF2-10
• CRF2-S1IL22BP
• CRF2-X
• Cytokine receptor class-II member 10
• Cytokine receptor family 2 member 10
• Cytokine receptor family type 2, soluble 1
• IL-22 RA2
• IL-22 receptor subunit alpha-2
• IL22BP
• IL-22BP
• IL-22BPCRF2X
• IL22RA2
• IL-22RA2
• IL-22R-alpha-2
• interleukin 22 receptor, alpha 2
• interleukin 22-binding protein
• interleukin-22 receptor subunit alpha-2
• Interleukin-22-binding protein
• MGC150509
• MGC150510
• zcytoR16

Background

The protein encoded by the IL22 RA2 gene is a soluble class II cytokine receptor. This protein has been shown to specificallybind to interleukin 22 (IL22), block the interaction of IL22 with its cell surface receptor, and thus inhibit IL22activity. This protein functions as an IL22 antagonist, and may be important in the regulation of inflammatoryresponse. Three alternatively spliced transcript variants encoding distinct isoforms have been described. (provided byRefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IL-22BP/IL22 RA2 Antibody (NBP1-85455)(2)

Publications using NBP1-85455

• Ciccia F, Guggino G, Rizzo A et al. IL-22 receptor 1 is over-expressed in primary Sjogren's Syndrome and Sjogren-associated non-Hodgkin lymphomas and is regulated by IL-18 Clin. Exp. Immunol. 2015-04-16 [PMID: 25880879] (IF/IHC, Human)
• H Laaksonen, A O Guerreiro-Cacais, M Z Adzemovic et al. The multiple sclerosis risk gene IL22RA2 contributes to a more severe murine autoimmune neuroinflammation. Genes and Immunity 2014-07-10 [PMID: 25008863] (ICC/IF, Mouse)

Bioinformatics

• Gene Symbol: IL22RA2