IL-22BP/IL22 RA2 Antibody

Images

 
Western Blot: IL22 RA2 Antibody [NBP1-85455] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: IL22 RA2 Antibody [NBP1-85455] - Staining of human kidney shows moderate cytoplasmic staining and luminal membrane positivity in tubules.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IL-22BP/IL22 RA2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IL22RA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
IL-22BP/IL22 RA2 Protein (NBP1-85455PEP)
Publications
Read Publications using
NBP1-85455 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25008863).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IL-22BP/IL22 RA2 Antibody

  • class II cytokine receptor
  • CRF2-10
  • CRF2-S1IL22BP
  • CRF2-X
  • Cytokine receptor class-II member 10
  • Cytokine receptor family 2 member 10
  • Cytokine receptor family type 2, soluble 1
  • IL-22 RA2
  • IL-22 receptor subunit alpha-2
  • IL22BP
  • IL-22BP
  • IL-22BPCRF2X
  • IL22RA2
  • IL-22RA2
  • IL-22R-alpha-2
  • interleukin 22 receptor, alpha 2
  • interleukin 22-binding protein
  • interleukin-22 receptor subunit alpha-2
  • Interleukin-22-binding protein
  • MGC150509
  • MGC150510
  • zcytoR16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB15041
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
AF874
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
AF1709
Species: Mu
Applications: WB, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ICFlow, ELISA(Sta)
1102-IL/CF
Species: Hu
AF1375
Species: Hu
Applications: WB
MAB42941
Species: Mu
Applications: Flow, CyTOF-ready, ICC
2915-IL/CF
Species: Mu
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-56409
Species: Hu, Mu
Applications: WB, Flow
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
1965-IL/CF
Species: Hu
409-ML/CF
Species: Mu
MAB6731
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut

Publications for IL-22BP/IL22 RA2 Antibody (NBP1-85455)(2)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 2 applications: ICC/IF, IHC.


Filter By Application
ICC/IF
(1)
IHC
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for IL-22BP/IL22 RA2 Antibody (NBP1-85455) (0)

There are no reviews for IL-22BP/IL22 RA2 Antibody (NBP1-85455). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-22BP/IL22 RA2 Antibody (NBP1-85455) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IL-22BP/IL22 RA2 Products

Bioinformatics Tool for IL-22BP/IL22 RA2 Antibody (NBP1-85455)

Discover related pathways, diseases and genes to IL-22BP/IL22 RA2 Antibody (NBP1-85455). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-22BP/IL22 RA2 Antibody (NBP1-85455)

Discover more about diseases related to IL-22BP/IL22 RA2 Antibody (NBP1-85455).
 

Pathways for IL-22BP/IL22 RA2 Antibody (NBP1-85455)

View related products by pathway.

PTMs for IL-22BP/IL22 RA2 Antibody (NBP1-85455)

Learn more about PTMs related to IL-22BP/IL22 RA2 Antibody (NBP1-85455).
 

Research Areas for IL-22BP/IL22 RA2 Antibody (NBP1-85455)

Find related products by research area.

Blogs on IL-22BP/IL22 RA2

There are no specific blogs for IL-22BP/IL22 RA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-22BP/IL22 RA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IL22RA2
Entrez