IL-18 BPa/IL18BP Recombinant Protein Antigen

Images

 
There are currently no images for IL-18 BPa/IL18BP Protein (NBP2-38481PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IL-18 BPa/IL18BP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL18BP.

Source: E. coli

Amino Acid Sequence: RLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IL18BP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38481.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IL-18 BPa/IL18BP Recombinant Protein Antigen

  • IL18 BPa
  • IL-18 BPa
  • IL18BP
  • IL-18BP
  • IL18BPa
  • interleukin 18 binding protein
  • interleukin-18-binding protein
  • MC51L-53L-54L homolog gene product
  • tadekinig-alfa

Background

IL-18BP which binds to IL-18, also known as interferon-gamma inducing factor (IGIF) which is a pro-inflammatory cytokine that belongs to the IL-1 family (1). IL-18 is a pleiotropic factor involved in the regulation of both innate and acquired immune responses, playing a key role in autoimmune, inflammatory, and infectious diseases (2). Interleukin-18 binding protein (IL18-BP) is an inhibitor of the pro-inflammatory cytokine IL18. The recombinant forms of IL18BP did not exhibit species specificity and prevented interleukin-18 binding to its receptor. In addition, they inhibited interleukine-18 dependent IFN-gamma production from KG-1 cells effectively. These results suggest that the interleukin-18 binding protein may possess interleukine-18 antagonist activity (3). IL-18 plays an important role in host defense against microbial pathogens. Many poxviruses encode homologous IL-18BP that neutralizes IL-18 activity. Data show that IL-18BP prevents IL-18 from binding to IL-18R by interacting with three residues that are part of the binding site for IL-18Ralpha (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

7625
Species: Mu
Applications: ELISA
485-MI
Species: Mu
Applications: BA
6507-IL/CF
Species: Hu
Applications: BA
M6000B
Species: Mu
Applications: ELISA
247-ILB
Species: Hu
Applications: BA
NB100-56565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
MAB840
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, Neut
DY417
Species: Mu
Applications: ELISA
DRA00B
Species: Hu
Applications: ELISA
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
AF856
Species: Mu
Applications: CyTOF-ready, Flow, Neut, WB

Publications for IL-18 BPa/IL18BP Protein (NBP2-38481PEP) (0)

There are no publications for IL-18 BPa/IL18BP Protein (NBP2-38481PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-18 BPa/IL18BP Protein (NBP2-38481PEP) (0)

There are no reviews for IL-18 BPa/IL18BP Protein (NBP2-38481PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IL-18 BPa/IL18BP Protein (NBP2-38481PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IL-18 BPa/IL18BP Products

Research Areas for IL-18 BPa/IL18BP Protein (NBP2-38481PEP)

Find related products by research area.

Blogs on IL-18 BPa/IL18BP

There are no specific blogs for IL-18 BPa/IL18BP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IL-18 BPa/IL18BP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IL18BP