IL-18 BPa/IL18BP Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL18BP. Source: E. coli
Amino Acid Sequence: RLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
IL18BP |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38481. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for IL-18 BPa/IL18BP Recombinant Protein Antigen
Background
IL-18BP which binds to IL-18, also known as interferon-gamma inducing factor (IGIF) which is a pro-inflammatory cytokine that belongs to the IL-1 family (1). IL-18 is a pleiotropic factor involved in the regulation of both innate and acquired immune responses, playing a key role in autoimmune, inflammatory, and infectious diseases (2). Interleukin-18 binding protein (IL18-BP) is an inhibitor of the pro-inflammatory cytokine IL18. The recombinant forms of IL18BP did not exhibit species specificity and prevented interleukin-18 binding to its receptor. In addition, they inhibited interleukine-18 dependent IFN-gamma production from KG-1 cells effectively. These results suggest that the interleukin-18 binding protein may possess interleukine-18 antagonist activity (3). IL-18 plays an important role in host defense against microbial pathogens. Many poxviruses encode homologous IL-18BP that neutralizes IL-18 activity. Data show that IL-18BP prevents IL-18 from binding to IL-18R by interacting with three residues that are part of the binding site for IL-18Ralpha (4).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: ELISA
Species: Mu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Mu
Applications: WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, Neut
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: Neut, WB
Publications for IL-18 BPa/IL18BP Protein (NBP2-38481PEP) (0)
There are no publications for IL-18 BPa/IL18BP Protein (NBP2-38481PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IL-18 BPa/IL18BP Protein (NBP2-38481PEP) (0)
There are no reviews for IL-18 BPa/IL18BP Protein (NBP2-38481PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for IL-18 BPa/IL18BP Protein (NBP2-38481PEP) (0)
Additional IL-18 BPa/IL18BP Products
Research Areas for IL-18 BPa/IL18BP Protein (NBP2-38481PEP)
Find related products by research area.
|
Blogs on IL-18 BPa/IL18BP