IL-1 RII Recombinant Protein Antigen

Images

 
There are currently no images for IL-1 RII Protein (NBP1-86550PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IL-1 RII Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL1R2.

Source: E. coli

Amino Acid Sequence: GALWLLPALQEDSGTYVCTTRNASYCDKMSIELRVFENTDAFLPFISYPQILTLSTSGVLVCPDLSEFTRDKTDVKIQWYKDSLLLDK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IL1R2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86550.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IL-1 RII Recombinant Protein Antigen

  • beta
  • CD121b antigen
  • CD121b
  • IL-1 R beta
  • IL-1 RII
  • IL1R2
  • IL1RBCD121 antigen-like family member B
  • IL-1R-beta
  • IL1RII
  • IL-1RII
  • IL-1RT2
  • IL-1RT-2
  • interleukin 1 receptor, type II
  • Interleukin-1 receptor beta
  • MGC47725

Background

The protein encoded by the IL1R2 gene is a cytokine receptor that belongs to the interleukin 1 receptor family. This protein binds interleukin alpha (IL1A), interleukin beta (IL1B), and interleukin 1 receptor, type I(IL1R1/IL1RA), and acts as a decoy receptor that inhibits the activity of its ligands. Interleukin 4 (IL4) is reported to antagonize the activity of interleukin 1 by inducing the expression and release of this cytokine. This gene and three other genes form a cytokine receptor gene cluster on chromosome 2q12. Two alternatively spliced transcript variants encoding the same protein have been reported. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

201-LB
Species: Hu
Applications: BA
M6000B
Species: Mu
Applications: ELISA
DRA00B
Species: Hu
Applications: ELISA
AF771
Species: Mu
Applications: IHC, Neut, WB
200-LA
Species: Hu
Applications: BA
AF676
Species: Hu
Applications: CyTOF-ready, Flow, WB
7268-CT
Species: Hu
Applications: BA
DRN00B
Species: Hu
Applications: ELISA
7954-GM/CF
Species: Hu
Applications: BA
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
DRT100
Species: Hu
Applications: ELISA
7625
Species: Mu
Applications: ELISA
DY417
Species: Mu
Applications: ELISA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
AF2940
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
NBP1-82991
Species: Hu
Applications: ChIP-EXO-SEQ, IHC,  IHC-P, WB

Publications for IL-1 RII Protein (NBP1-86550PEP) (0)

There are no publications for IL-1 RII Protein (NBP1-86550PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-1 RII Protein (NBP1-86550PEP) (0)

There are no reviews for IL-1 RII Protein (NBP1-86550PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IL-1 RII Protein (NBP1-86550PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IL-1 RII Products

Research Areas for IL-1 RII Protein (NBP1-86550PEP)

Find related products by research area.

Blogs on IL-1 RII

There are no specific blogs for IL-1 RII, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IL-1 RII Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IL1R2