IKK epsilon/IKBKE Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IKBKE. Source: E. coli
Amino Acid Sequence: IHKLDKVNFSHLAKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQESLSKLLEELSHQLLQDRAKGAQASPPPIAPYPSPTRKDLLLHMQELCEGMKLLASDLLDNNRIIERLN Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
IKBKE |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83114. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
33 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for IKK epsilon/IKBKE Recombinant Protein Antigen
Background
Nuclear Factor kappa B (NF-kB) is a ubiquitous transcription factor and an essential mediator of gene expression during the activation of immune and inflammatory responses. NF-kB mediates the expression of a great variety of genes in response to extracellular stimuli. NF-kB is associated with IkB proteins in the cytoplasm of the cell, which inhibit NF-kB activity. IkB proteins are phosphorylated by an IkB kinase complex consisting of at least three proteins, IKKa, IKKb, and IKKg. Isolated from a cDNA library of LPS-stimulated mouse macrophage cells, a novel molecule in the IKK complex has been recently identified and designated IKKi and/or IKKe. IKKe is required for the activation of NF-kB by mitogens and T cell receptors but not by TNFa or IL-1. LPS increases the IKKe mRNA level in mouse macrophage cell lines. This protein has significant sequence homology with kinase domains of IKKa and IKKb. Overexpression of wild type IKKe in cells phosphorylates Ser32 and Ser36 of IkBa.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IB, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: B/N, Func-Inh, In vitro, In vivo
Species: Rt
Applications: ICC, IHC, IP, KO, WB
Species: Mu, Rt
Applications: WB
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
Species: Bv, Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Pa
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: AC
Publications for IKK epsilon/IKBKE Protein (NBP1-83114PEP) (0)
There are no publications for IKK epsilon/IKBKE Protein (NBP1-83114PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IKK epsilon/IKBKE Protein (NBP1-83114PEP) (0)
There are no reviews for IKK epsilon/IKBKE Protein (NBP1-83114PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for IKK epsilon/IKBKE Protein (NBP1-83114PEP) (0)
Additional IKK epsilon/IKBKE Products
Research Areas for IKK epsilon/IKBKE Protein (NBP1-83114PEP)
Find related products by research area.
|
Blogs on IKK epsilon/IKBKE