Recombinant Human IKBKAP Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human IKBKAP Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1242-1331 of Human IKBKAP

Source: Wheat Germ

Amino Acid Sequence: VLFLFEFDEQGRELQKAFEDTLQLMERSLPEIWTLTYQQNSATPVLGPNSTANSIMASYQQQKTSVPVLDAELFIPPKINRRTQWKLSLL

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ELP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
35.64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IKBKAP Protein

  • DYS
  • elongator complex protein 1
  • ELP1DKFZp781H1425
  • FD
  • FLJ12497
  • IKAPdysautonomia (Riley-Day syndrome, hereditary sensory autonomic neuropathy typeIII)
  • IkappaB kinase complex-associated protein
  • IKI3
  • IKK complex-associated protein
  • inhibitor of kappa light polypeptide gene enhancer in B-cells, kinasecomplex-associated protein
  • p150
  • TOT1

Background

IKBKAP - inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase complex-associated protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1730
Species: Hu
Applications: Flow, AdBlk, CyTOF-ready, ICC
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
NB110-89474
Species: Hu, Mu, Rt, Bv, ChHa
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Single Cell Western
AF1008
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NB110-97871
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
796-IC
Species: Mu
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
H00001523-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00008518-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for IKBKAP Partial Recombinant Protein (H00008518-Q01) (0)

There are no publications for IKBKAP Partial Recombinant Protein (H00008518-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IKBKAP Partial Recombinant Protein (H00008518-Q01) (0)

There are no reviews for IKBKAP Partial Recombinant Protein (H00008518-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IKBKAP Partial Recombinant Protein (H00008518-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional IKBKAP Products

Bioinformatics Tool for IKBKAP Partial Recombinant Protein (H00008518-Q01)

Discover related pathways, diseases and genes to IKBKAP Partial Recombinant Protein (H00008518-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IKBKAP Partial Recombinant Protein (H00008518-Q01)

Discover more about diseases related to IKBKAP Partial Recombinant Protein (H00008518-Q01).
 

Pathways for IKBKAP Partial Recombinant Protein (H00008518-Q01)

View related products by pathway.

PTMs for IKBKAP Partial Recombinant Protein (H00008518-Q01)

Learn more about PTMs related to IKBKAP Partial Recombinant Protein (H00008518-Q01).
 

Research Areas for IKBKAP Partial Recombinant Protein (H00008518-Q01)

Find related products by research area.

Blogs on IKBKAP

There are no specific blogs for IKBKAP, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IKBKAP Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ELP1