IGSF8/CD316 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: PDVLQVSAAPPGPRGRQAPTSPPRMTVHEGQELALGCLARTSTQKHTHLAVSFGRSVPEAPVGRSTLQEVVGIRSDLAVEAGAPYAERLAAGELRLGKEGTDRYRMVVGGAQAGDAGTYHCTAAEWIQDPDGSWAQIAEKRAVLAHVDVQ |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
IGSF8 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for IGSF8/CD316 Antibody - BSA Free
Background
IGSF8 is a gene that codes for a protein that plays a role in diverse functions from oocytes fertilization to hepatitis C virus function, as well as working as a regulator of cell motility and neurite outgrowth and has three isomers with lengths of 613, 372, and 526 amino acids and weights of approximately 65, 40, and 56 kDa respectively. Current studies are being done on several diseases and disorders related to this gene including hepatitis C, prostate cancer, and glioblastoma. IGSF8 has also been shown to have interactions with CD81, CD9, CD82, ITGB1, and ADAM10.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, In vitro, WB
Species: Gt, Hu, Mu, Pm, Sh
Applications: CyTOF-ready, DB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, Neut
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
Species: Mu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Mu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ELISA(Sta), ELISA, Flow, WB
Species: Hu, Mu
Applications: B/N, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vivo
Species: Mu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: WB, IHC
Publications for IGSF8/CD316 Antibody (NBP1-85761) (0)
There are no publications for IGSF8/CD316 Antibody (NBP1-85761).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IGSF8/CD316 Antibody (NBP1-85761) (0)
There are no reviews for IGSF8/CD316 Antibody (NBP1-85761).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for IGSF8/CD316 Antibody (NBP1-85761) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional IGSF8/CD316 Products
Research Areas for IGSF8/CD316 Antibody (NBP1-85761)
Find related products by research area.
|
Blogs on IGSF8/CD316