IGSF8/CD316 Antibody

Images

 
Western Blot: IGSF8/CD316 Antibody [NBP1-85761] - Analysis in human cerebral cortex tissue.
Immunohistochemistry-Paraffin: IGSF8/CD316 Antibody [NBP1-85761] - Staining of human cerebellum shows strong positivity in neuronal processes.
Immunohistochemistry-Paraffin: IGSF8/CD316 Antibody [NBP1-85761] - Staining of human adrenal gland shows moderate positivity in cortical cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IGSF8/CD316 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PDVLQVSAAPPGPRGRQAPTSPPRMTVHEGQELALGCLARTSTQKHTHLAVSFGRSVPEAPVGRSTLQEVVGIRSDLAVEAGAPYAERLAAGELRLGKEGTDRYRMVVGGAQAGDAGTYHCTAAEWIQDPDGSWAQIAEKRAVLAHVDVQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IGSF8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
IGSF8/CD316 Protein (NBP1-85761PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IGSF8/CD316 Antibody

  • CD316 antigen
  • CD316
  • CD81P3
  • CD81P3LIR-D1
  • EWI2
  • EWI-2
  • EWI2CD81 partner 3
  • Glu-Trp-Ile EWI motif-containing protein 2
  • IGSF8
  • immunoglobulin superfamily, member 8
  • KCT4
  • KCT-4
  • Keratinocytes-associated transmembrane protein 4
  • PGRL
  • PGRLimmunoglobulin superfamily member 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22187
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, IF
NB100-65805
Species: Hu, Gt, Pm, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-56516
Species: Hu, Mu
Applications: WB, IHC
AF165
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF1162
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
MAB10541
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
NBP1-76775
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90310
Species: Hu
Applications: WB, IHC, IHC-P
AF2087
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF4495
Species: Mu
Applications: WB, Flow, CyTOF-ready
AF193
Species: Hu, Pm
Applications: WB, Flow, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
DDX0390P-100
Species: Mu
Applications: B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vivo
MAB3368
Species: Mu
Applications: Flow, CyTOF-ready
NBP1-85761
Species: Hu
Applications: WB, IHC, IHC-P

Publications for IGSF8/CD316 Antibody (NBP1-85761) (0)

There are no publications for IGSF8/CD316 Antibody (NBP1-85761).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGSF8/CD316 Antibody (NBP1-85761) (0)

There are no reviews for IGSF8/CD316 Antibody (NBP1-85761). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IGSF8/CD316 Antibody (NBP1-85761) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IGSF8/CD316 Antibody Products

Related Products by Gene

Bioinformatics Tool for IGSF8/CD316 Antibody (NBP1-85761)

Discover related pathways, diseases and genes to IGSF8/CD316 Antibody (NBP1-85761). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGSF8/CD316 Antibody (NBP1-85761)

Discover more about diseases related to IGSF8/CD316 Antibody (NBP1-85761).
 

Pathways for IGSF8/CD316 Antibody (NBP1-85761)

View related products by pathway.

PTMs for IGSF8/CD316 Antibody (NBP1-85761)

Learn more about PTMs related to IGSF8/CD316 Antibody (NBP1-85761).
 

Research Areas for IGSF8/CD316 Antibody (NBP1-85761)

Find related products by research area.

Blogs on IGSF8/CD316

There are no specific blogs for IGSF8/CD316, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IGSF8/CD316 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IGSF8
Entrez

Customers Who Bought This Also Bought