IGSF8/CD316 Antibody

Images

 
Western Blot: IGSF8 Antibody [NBP1-85761] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)
Immunohistochemistry-Paraffin: IGSF8 Antibody [NBP1-85761] - Staining of human adrenal gland shows moderate positivity in cortical cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

IGSF8/CD316 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PDVLQVSAAPPGPRGRQAPTSPPRMTVHEGQELALGCLARTSTQKHTHLAVSFGRSVPEAPVGRSTLQEVVGIRSDLAVEAGAPYAERLAAGELRLGKEGTDRYRMVVGGAQAGDAGTYHCTAAEWIQDPDGSWAQIAEKRAVLAHVDVQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IGSF8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
IGSF8/CD316 Protein (NBP1-85761PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (87%)

Alternate Names for IGSF8/CD316 Antibody

  • CD316 antigen
  • CD316
  • CD81P3
  • CD81P3LIR-D1
  • EWI2
  • EWI-2
  • EWI2CD81 partner 3
  • Glu-Trp-Ile EWI motif-containing protein 2
  • IgSF8
  • IGSF8/CD316
  • immunoglobulin superfamily, member 8
  • KCT4
  • KCT-4
  • Keratinocytes-associated transmembrane protein 4
  • PGRL
  • PGRLimmunoglobulin superfamily member 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22187
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NB100-65805
Species: Hu, Gt, Pm, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56516
Species: Hu, Mu
Applications: WB, IHC
AF1162
Species: Hu
Applications: WB, Flow, Neut
NBP1-76775
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90310
Species: Hu
Applications: WB, IHC, IHC-P
44240002
Species: Hu
Applications: WB, ELISA
NBP2-27154
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, Flow, IHC-P
MAB3368
Species: Mu
Applications: Flow
NBP1-85761
Species: Hu
Applications: WB, IHC, IHC-P

Publications for IGSF8/CD316 Antibody (NBP1-85761) (0)

There are no publications for IGSF8/CD316 Antibody (NBP1-85761).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGSF8/CD316 Antibody (NBP1-85761) (0)

There are no reviews for IGSF8/CD316 Antibody (NBP1-85761). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IGSF8/CD316 Antibody (NBP1-85761) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IGSF8/CD316 Antibody Products

Related Products by Gene

Bioinformatics Tool for IGSF8/CD316 Antibody (NBP1-85761)

Discover related pathways, diseases and genes to IGSF8/CD316 Antibody (NBP1-85761). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGSF8/CD316 Antibody (NBP1-85761)

Discover more about diseases related to IGSF8/CD316 Antibody (NBP1-85761).
 

Pathways for IGSF8/CD316 Antibody (NBP1-85761)

View related products by pathway.

PTMs for IGSF8/CD316 Antibody (NBP1-85761)

Learn more about PTMs related to IGSF8/CD316 Antibody (NBP1-85761).
 

Research Areas for IGSF8/CD316 Antibody (NBP1-85761)

Find related products by research area.

Blogs on IGSF8/CD316

There are no specific blogs for IGSF8/CD316, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol IGSF8
Entrez

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-85761 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought