IGSF4B/SynCAM3/CADM3 Antibody

Images

 
Western Blot: IGSF4B/SynCAM3/CADM3 Antibody [NBP1-88604] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: IGSF4B/SynCAM3/CADM3 Antibody [NBP1-88604] - Staining of human cerebellum shows strong positivity in neuropil.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IGSF4B/SynCAM3/CADM3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CADM3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
IGSF4B/SynCAM3/CADM3 Protein (NBP1-88604PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IGSF4B/SynCAM3/CADM3 Antibody

  • BIgR
  • Brain immunoglobulin receptor
  • CADM3
  • cell adhesion molecule 3
  • IGSF4B
  • IGSF4BSynCAM3
  • Immunoglobulin superfamily member 4B
  • member 4B
  • Necl-1
  • NECL1TSLC1-like protein 1
  • Nectin-like protein 1
  • Synaptic cell adhesion molecule 3
  • SynCAM3
  • TSLC1-like 1
  • TSLL1
  • TSLL1SYNCAM3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-186
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF
NBP1-89636
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB25301
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF3064
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NB100-2421
Species: Hu
Applications: WB, Flow, IHC, IHC-P, PEP-ELISA
NB100-1366
Species: Hu
Applications: WB, PEP-ELISA
AF7829
Species: Hu
Applications: WB, IHC, ICC
NBP2-01198
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
H00005956-R02
Species: Hu
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP1-88604
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for IGSF4B/SynCAM3/CADM3 Antibody (NBP1-88604) (0)

There are no publications for IGSF4B/SynCAM3/CADM3 Antibody (NBP1-88604).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGSF4B/SynCAM3/CADM3 Antibody (NBP1-88604) (0)

There are no reviews for IGSF4B/SynCAM3/CADM3 Antibody (NBP1-88604). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IGSF4B/SynCAM3/CADM3 Antibody (NBP1-88604) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IGSF4B/SynCAM3/CADM3 Products

Bioinformatics Tool for IGSF4B/SynCAM3/CADM3 Antibody (NBP1-88604)

Discover related pathways, diseases and genes to IGSF4B/SynCAM3/CADM3 Antibody (NBP1-88604). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGSF4B/SynCAM3/CADM3 Antibody (NBP1-88604)

Discover more about diseases related to IGSF4B/SynCAM3/CADM3 Antibody (NBP1-88604).
 

Pathways for IGSF4B/SynCAM3/CADM3 Antibody (NBP1-88604)

View related products by pathway.

PTMs for IGSF4B/SynCAM3/CADM3 Antibody (NBP1-88604)

Learn more about PTMs related to IGSF4B/SynCAM3/CADM3 Antibody (NBP1-88604).

Blogs on IGSF4B/SynCAM3/CADM3

There are no specific blogs for IGSF4B/SynCAM3/CADM3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IGSF4B/SynCAM3/CADM3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CADM3
Entrez