IGFL1 Antibody - BSA Free

Western Blot: IGFL1 Antibody [NBP2-83074] - Host: Rabbit. Target Name: IGFL1. Sample Type: Hela Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

IGFL1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human IGFL1. Peptide sequence: AVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRS The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IGFL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for IGFL1 Antibody - BSA Free

• APRG644
• IGF-like family member 1
• insulin growth factor-like family member 1
• UNQ644

Background

IGFL1 belongs to the insulin-like growth factor (IGF; see MIM 147440) family of signaling molecules that play criticalroles in cellular energy metabolism and in growth and development, especially prenatal growth (Emtage et al., 2006(PubMed 16890402)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IGFL1