IGFL4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: IGFL4 Antibody [NBP2-14603] - Staining of human cell line A549 shows localization to cytosol.
Immunohistochemistry-Paraffin: IGFL4 Antibody [NBP2-14603] - Staining of human cerebellum shows distinct positivity in processes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IGFL4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: FWPCFQHCCLESLGSQNQTVVRFKVPGMKPDCKSSPITRICAQEYHPKSPVSRSDLI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IGFL4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IGFL4 Protein (NBP2-14603PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IGFL4 Antibody

  • IGFL4 IGF-like family member 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33869
Species: Hu
Applications: IHC, IHC-P
NBP2-14603
Species: Hu
Applications: ICC/IF, IHC

Publications for IGFL4 Antibody (NBP2-14603) (0)

There are no publications for IGFL4 Antibody (NBP2-14603).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGFL4 Antibody (NBP2-14603) (0)

There are no reviews for IGFL4 Antibody (NBP2-14603). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for IGFL4 Antibody (NBP2-14603) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IGFL4 Products

Array NBP2-14603

Diseases for IGFL4 Antibody (NBP2-14603)

Discover more about diseases related to IGFL4 Antibody (NBP2-14603).

Blogs on IGFL4

There are no specific blogs for IGFL4, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IGFL4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IGFL4