IGFL4 Antibody


Immunocytochemistry/ Immunofluorescence: IGFL4 Antibody [NBP2-14603] - Staining of human cell line A549 shows localization to cytosol.
Immunohistochemistry-Paraffin: IGFL4 Antibody [NBP2-14603] - Staining of human cerebellum shows distinct positivity in processes.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

IGFL4 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: FWPCFQHCCLESLGSQNQTVVRFKVPGMKPDCKSSPITRICAQEYHPKSP VSRSDLI
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IGFL4 Protein (NBP2-14603PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for IGFL4 Antibody

  • IGFL4 IGF-like family member 4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for IGFL4 Antibody (NBP2-14603) (0)

There are no publications for IGFL4 Antibody (NBP2-14603).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGFL4 Antibody (NBP2-14603) (0)

There are no reviews for IGFL4 Antibody (NBP2-14603). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for IGFL4 Antibody (NBP2-14603) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional IGFL4 Products

IGFL4 NBP2-14603

Bioinformatics Tool for IGFL4 Antibody (NBP2-14603)

Discover related pathways, diseases and genes to IGFL4 Antibody (NBP2-14603). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGFL4 Antibody (NBP2-14603)

Discover more about diseases related to IGFL4 Antibody (NBP2-14603).

Blogs on IGFL4

There are no specific blogs for IGFL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our IGFL4 Antibody and receive a gift card or discount.


Gene Symbol IGFL4