IGF2BP1 Recombinant Protein Antigen

Images

 
There are currently no images for IGF2BP1 Protein (NBP1-83108PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IGF2BP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IGF2BP1.

Source: E.coli

Amino Acid Sequence: DVAAMSLQSHLIPGLNLAAVGLFPASSSAVPPPPSSVTGAAPYSSFMQAPEQEMVQVFIPAQAVGAIIGKK

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IGF2BP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-83108.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for IGF2BP1 Recombinant Protein Antigen

  • Coding region determinant-binding protein
  • CRD-BP
  • CRDBPIGF-II mRNA-binding protein 1
  • IGF II mRNA binding protein 1
  • IMP1
  • IMP-1ZBP-1
  • insulin-like growth factor 2 mRNA binding protein 1
  • insulin-like growth factor 2 mRNA-binding protein 1
  • VICKZ family member 1
  • VICKZ1
  • ZBP1IGF2 mRNA-binding protein 1
  • Zip code-binding protein 1
  • Zipcode-binding protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84339
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-22568
Species: Hu
Applications: IHC-P
NBP1-87512
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-81591
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57070
Species: Hu
Applications: WB
NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Mk, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
NB100-56583
Species: Hu
Applications: WB, Flow, IHC-P
248-BD
Species: Hu, Mu, Rt, Ca, Eq
NBP1-30975
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59475
Species: Hu
Applications: WB, ELISA, ICC/IF
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC

Publications for IGF2BP1 Protein (NBP1-83108PEP) (0)

There are no publications for IGF2BP1 Protein (NBP1-83108PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGF2BP1 Protein (NBP1-83108PEP) (0)

There are no reviews for IGF2BP1 Protein (NBP1-83108PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for IGF2BP1 Protein (NBP1-83108PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for IGF2BP1 Protein (NBP1-83108PEP)

Discover related pathways, diseases and genes to IGF2BP1 Protein (NBP1-83108PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGF2BP1 Protein (NBP1-83108PEP)

Discover more about diseases related to IGF2BP1 Protein (NBP1-83108PEP).
 

Pathways for IGF2BP1 Protein (NBP1-83108PEP)

View related products by pathway.

PTMs for IGF2BP1 Protein (NBP1-83108PEP)

Learn more about PTMs related to IGF2BP1 Protein (NBP1-83108PEP).

Blogs on IGF2BP1

There are no specific blogs for IGF2BP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IGF2BP1 Antibody
NBP2-38956

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IGF2BP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IGF2BP1