Recombinant Human IGF-II/IGF2 Protein

Product Discontinued

Recombinant Human IGF-II/IGF2 Protein Summary

• Description: Recombinant biologically active IGF2 protein.

  Source:E. coli

  Amino Acid Sequence: AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE

• Details of Functionality: Recombinant Human Insulin Like Growth Factor-II is fully biologically active when compared to standards.The ED50, calculated by the dose-dependent induction of MCF-7 cell proliferation was found to be 0.85ng/ml corresponding to a Specific Activity of 1,176,470 IU/mg.
• Source: E. coli
• Protein/Peptide Type: Recombinant Protein
• Gene: IGF2
• Purity: > 97 % pure by SDS-PAGE and HPLC
• Endotoxin Note: Less than 0.1 ng/ug (IEU/ug) of IGF-II.

Applications/Dilutions

• Dilutions:
  • Bioactivity
• Theoretical MW: 7.5 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: Lyophilized with no additives.
• Preservative: No Preservative
• Concentration: LYOPH
• Purity: > 97 % pure by SDS-PAGE and HPLC
• Reconstitution Instructions: Reconstitute with sterilized 18 M omega-cm water to a final concentration of at least 0.1 mg/ml.

Notes

After reconstitution, store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Alternate Names for Recombinant Human IGF-II/IGF2 Protein

• C11orf43
• chromosome 11 open reading frame 43
• FLJ22066
• FLJ44734
• GRDF
• IGF2
• IGF-2
• IGFII
• IGF-II
• insulin-like growth factor 2 (somatomedin A)
• insulin-like growth factor II
• insulin-like growth factor type 2
• MSA
• PEG2
• PP9974
• somatomedin-A

Background

IGF-2 is a member of the insulin family of polypeptide growth factors that is involved in development and growth. It is an imprinted gene and is expressed only from the paternally inherited allele. It is a candidate gene for eating disorders. There is a read-through, INS-IGF2, which aligns to this gene at the 3' region and to the upstream INS gene at the 5' region. Two alternatively spliced transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for IGF-II/IGF2 Recombinant Protein (NBP2-26544)(1)

Publication using NBP2-26544

• Li P, Cavallero S, Gu Y et al. IGF signaling directs ventricular cardiomyocyte proliferation during embryonic heart development. Development. 2011-05-01 [PMID: 21429986] (WB)
  
  Details:
  Insulin Like Growth Factor-II (IMR-235). WB: MEC1 cell line, Fig 2A.

Bioinformatics

• Gene Symbol: IGF2