IgA2 Antibody - Azide and BSA Free Summary
| Description |
Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen |
IGHA2 (AAH73765.1, 1 a.a. - 477 a.a.) full-length human protein. MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQTAGKGLEWIGYISHSGSTTYNPSLKSRVTLSLDTSKNQFSLRLNSVTAADTAVYYCAHGSSWDFAFDYWGQGTLVTVSSASPTSPKVFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQNVTARNFPPSQDASGDLYTTSSQLTLPATQCPDGKSVTCHVKHYTNPSQDVTVPCPVPPPPPCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGATFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAQPWNHGETFTCTAAHPELKTPLTANITKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDGTCY |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
IGHA2 |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence
- Western Blot
|
| Application Notes |
It has been used for WB and IF. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for IgA2 Antibody - Azide and BSA Free
Background
Hybridoma clone has been derived from hybridization of Sp2/0 myeloma cells with spleen cells of Balb/c mice immunised with human IgA2 from myeloma patient serum.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: Ctrl
Species: Hu
Applications: ICC, IP, Simple Western, WB
Species: Sh
Applications: ELISA, IHC, IHC-Fr, WB
Species: Hu
Applications: Flow-CS, Flow-IC, Flow, IF, IHC, IHC-Fr, IHC-P
Species: Gt
Applications: Ctrl
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, PA
Species: Hu
Applications: IHC, IHC-P
Species: Ch
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA
Species: Mu
Applications: BA
Publications for IGHA2 Antibody (H00003494-B01P) (0)
There are no publications for IGHA2 Antibody (H00003494-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IGHA2 Antibody (H00003494-B01P) (0)
There are no reviews for IGHA2 Antibody (H00003494-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for IGHA2 Antibody (H00003494-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional IgA2 Products
Research Areas for IGHA2 Antibody (H00003494-B01P)
Find related products by research area.
|
Blogs on IgA2