IFT81 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: IFT81 Antibody [NBP1-84557] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry: IFT81 Antibody [NBP1-84557] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IFT81 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IKFIMDSLNKEPFRKNYNLITFDSLEPMQLLQVLSDVLAEIDPKQLVDIREEMPEQTAKRMLSLLGILKYKPSGNATDMSTFRQGLVIGSKPVIYPVLHWLLQRTNELKKR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IFT81
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IFT81 Protein (NBP1-84557PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IFT81 Antibody

  • carnitine deficiency-associated gene expressed in ventricle 1
  • Carnitine deficiency-associated protein expressed in ventricle 1
  • CDV-1
  • CDV1carnitine deficiency-associated, expressed in ventricle 1
  • CDV1R
  • CDV-1R
  • intraflagellar transport 81 homolog (Chlamydomonas)
  • intraflagellar transport protein 81 homolog
  • MGC102777
  • MGC4027

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57222
Species: Hu
Applications: ICC/IF
NBP1-46218
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
MAB17791
Species: Hu, Mu
Applications: WB
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB100-410
Species: Hu, Mu
Applications: WB, IP
AF5535
Species: Hu
Applications: WB, Simple Western
NBP1-87814
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-55756
Species: Hu
Applications: IHC-P
NBP1-85699
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89910
Species: Hu
Applications: IHC, IHC-P
NBP2-15564
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-822
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-84557
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for IFT81 Antibody (NBP1-84557) (0)

There are no publications for IFT81 Antibody (NBP1-84557).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFT81 Antibody (NBP1-84557) (0)

There are no reviews for IFT81 Antibody (NBP1-84557). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for IFT81 Antibody (NBP1-84557) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IFT81 Products

Bioinformatics Tool for IFT81 Antibody (NBP1-84557)

Discover related pathways, diseases and genes to IFT81 Antibody (NBP1-84557). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFT81 Antibody (NBP1-84557)

Discover more about diseases related to IFT81 Antibody (NBP1-84557).
 

Pathways for IFT81 Antibody (NBP1-84557)

View related products by pathway.

Blogs on IFT81

There are no specific blogs for IFT81, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFT81 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFT81