IFT74 Antibody

Images

 
Immunohistochemistry-Paraffin: IFT74 Antibody [NBP1-86580] - Staining of human fallopian tube shows strong membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IFT74 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KIKKLHQERMILSTHRNAFKKIMEKQNIEYEALKTQLQENETHSQLTNLERKWQHLEQNNFAMKEFIATKSQESDYQPIKKNVTKQIAEYNKTIVDALHSTSG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IFT74
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
IFT74 Protein (NBP1-86580PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IFT74 Antibody

  • Capillary morphogenesis gene 1 protein
  • CCDC2capillary morphogenesis protein 1
  • CMG1Coiled-coil domain-containing protein 2
  • CMG-1MGC111562
  • coiled-coil domain containing 2
  • FLJ22621
  • intraflagellar transport 74 homolog (Chlamydomonas)
  • intraflagellar transport protein 74 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88667
Species: Hu
Applications: IHC, IHC-P
NB100-1939
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
NBP1-92510
Species: Hu
Applications: IHC, IHC-P
NBP2-41181
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89910
Species: Hu
Applications: IHC, IHC-P
NBP1-86274
Species: Hu
Applications: WB, IHC, IHC-P, INHIB T-cell
NBP1-82474
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2437
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-90686
Species: Hu
Applications: IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1436
Species: Mu
Applications: WB
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-55756
Species: Hu
Applications: IHC-P
NB100-2475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-31293
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-86580
Species: Hu
Applications: IHC, IHC-P

Publications for IFT74 Antibody (NBP1-86580) (0)

There are no publications for IFT74 Antibody (NBP1-86580).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFT74 Antibody (NBP1-86580) (0)

There are no reviews for IFT74 Antibody (NBP1-86580). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IFT74 Antibody (NBP1-86580) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IFT74 Products

Bioinformatics Tool for IFT74 Antibody (NBP1-86580)

Discover related pathways, diseases and genes to IFT74 Antibody (NBP1-86580). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFT74 Antibody (NBP1-86580)

Discover more about diseases related to IFT74 Antibody (NBP1-86580).
 

Pathways for IFT74 Antibody (NBP1-86580)

View related products by pathway.

Blogs on IFT74

There are no specific blogs for IFT74, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFT74 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFT74