![Western Blot: IFN-alpha G/IFNA5 Antibody [NBP2-82257] - WB Suggested Anti-IFNA5 antibody Titration: 1 ug/mL. Sample Type: Human 293T Whole Cell](http://images.novusbio.com/fullsize/IFN-alpha-G-IFNA5-Antibody-Western-Blot-NBP2-82257-img0001.jpg "Western Blot: IFN-alpha G/IFNA5 Antibody [NBP2-82257] - WB Suggested Anti-IFNA5 antibody Titration: 1 ug/mL. Sample Type: Human 293T Whole Cell")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | Novus Biologicals Rabbit IFN-alpha G/IFNA5 Antibody - BSA Free (NBP2-82257) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human IFNA5. Peptide sequence: VLLMALVVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKD The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | IFNA5 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 20 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Western Blot IFN-alpha K Antibody (1009720) [Unconjugated]](https://images.novusbio.com/images2/IFNalpha_K_MAB10212_Western_Blot_23521.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | IFNA5 |
![IFN-alpha [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "IFN-alpha [Unconjugated]")
![Binding Activity IFN-beta [Unconjugated]](https://images.novusbio.com/images2/IFNbeta_8499IF_1038.jpg)
![Bioactivity IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFNgamma_285IF_2848.jpg)
![SDS-PAGE IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFN-gamma_285-IF_230.jpg)
![SEC-MALS IFN-gamma [Unconjugated]](https://images.novusbio.com/images/285-if_recombinant-human-ifn-gamma-protein-sec-mals-1520239228..jpg)
![Immunohistochemistry CD34 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD34_AF4117_Immunohistochemistry_6824.jpg)
![Immunohistochemistry Podocalyxin Like Antibody [Unconjugated]](https://images.novusbio.com/images2/Podocalyxin_AF1556_Immunohistochemistry_11445.jpg)
![Western Blot Podocalyxin Like Antibody [Unconjugated]](https://images.novusbio.com/images2/Podocalyxin_AF1556_Western_Blot_12581.jpg)
![Immunocytochemistry/ Immunofluorescence Podocalyxin Like Antibody [Unconjugated]](https://images.novusbio.com/images/af1556_mouse-podocalyxin-affinity-purified-polyclonal-ab-41202410485429.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
