IFN-alpha B2/IFN-alpha 8 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human IFN-alpha B2/IFN-alpha 8. Peptide sequence: ILAVRKYFQRITLYLTEKKYSSCAWEVVRAEIMRSFSLSINLQKRLKSKE The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
IFNA8 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
20 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for IFN-alpha B2/IFN-alpha 8 Antibody - BSA Free
Background
Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of twoenzymes: a protein kinase and an oligoadenylate synthetase
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: ChIP, Flow, KD, PEP-ELISA, WB
Species: Hu
Applications: ELISA, S-ELISA, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Publications for IFN-alpha B2/IFN-alpha 8 Antibody (NBP2-82256) (0)
There are no publications for IFN-alpha B2/IFN-alpha 8 Antibody (NBP2-82256).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IFN-alpha B2/IFN-alpha 8 Antibody (NBP2-82256) (0)
There are no reviews for IFN-alpha B2/IFN-alpha 8 Antibody (NBP2-82256).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for IFN-alpha B2/IFN-alpha 8 Antibody (NBP2-82256) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional IFN-alpha B2/IFN-alpha 8 Products
Research Areas for IFN-alpha B2/IFN-alpha 8 Antibody (NBP2-82256)
Find related products by research area.
|
Blogs on IFN-alpha B2/IFN-alpha 8