Home » IFITM3/Fragilis » Fragilis Peptides and Proteins » Recombinant Human IFITM3/Fragilis GST (N-Term) Protein

Recombinant Human IFITM3/Fragilis GST (N-Term) Protein

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, Func, PA, AP

Order Details

100% Guarantee on every product

Recombinant Human IFITM3/Fragilis GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-133 of Human IFITM3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
IFITM3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Functional
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
40.37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00010410-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IFITM3/Fragilis GST (N-Term) Protein

  • 1-8U
  • Fragilis
  • IFITM3
  • interferon induced transmembrane protein 3 (1-8U)
  • interferon-induced transmembrane protein 3
  • Interferon-inducible protein 1-8U
  • IP15
  • mil-1

Background

IFITM3( AAH06794, 1 a.a. - 134 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

IFITM1 Antibody
NBP1-89345
Immunocytochemistry/Immunofluorescence: IFITM1 Antibody [NBP1-89345] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: IFITM1 Antibody [NBP1-89345] - Staining in human epididymis and testis tissues using anti-IFITM1 antibody. Corresponding IFITM1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: IFITM1 Antibody [NBP1-89345] - Staining of human epididymis shows strong membranous positivity in ependymal cells.
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
IFITM2 Antibody
(1F2)
H00010581-M14
Sandwich ELISA: IFITM2 Antibody (1F2) [H00010581-M14] - Detection limit for recombinant GST tagged IFITM2 is 0.1 ng/ml as a capture antibody.
Western Blot: IFITM2 Antibody (1F2) [H00010581-M14] - Analysis of IFITM2 expression in transfected 293T cell line by IFITM2 monoclonal antibody (M14), clone 1F2. Lane 1: IFITM2 transfected lysate (Predicted MW: 14.6 KDa). Lane 2: Non-transfected lysate.
Western Blot: IFITM2 Antibody (1F2) [H00010581-M14] - Analysis of IFITM2 expression in HepG2 (Cat # L019V1).
Species: Hu
Applications: ELISA, S-ELISA, WB
IFN-alpha 1
Antibody
NBP2-75930
Western Blot: IFN-alpha 1 Antibody [NBP2-75930] - analysis of IFNA1 on mouse liver tissue lysate using anti-IFNA1 antibody at 1/100 dilution.
Immunocytochemistry/Immunofluorescence: IFN-alpha 1 Antibody [NBP2-75930] - staining IFNA1 in N2A cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: IFN-alpha 1 Antibody [NBP2-75930] - staining IFNA1 in SHG-44 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Oct-3/4 Antibody
[Unconjugated]
AF1759
BG01V human embryonic stem cells were fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. Oct‑3/4/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human/Mouse Oct‑3/4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1759) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The nanog promoter was detected by standard PCR.
Alkaline phosphatase (ALPL) and Oct‑3/4 were detected in human BG01V embryonic stem cells using 10 µg/mL Human/Mouse/Rat ALPL Monoclonal Antibody (Catalog # MAB1448) and 10 µg/mL Goat Anti-Human/Mouse Oct‑3/4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1759). Cells were incubated with primary antibodies for 3 hours at room temperature. Cells were stained for ALPL using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (pseudo-stained green; Catalog # NL007), and stained for Oct-3/4 using the NorthernLights 637-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL002). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of BG01V human embryonic stem cells and NTera‑2 human testicular embryonic carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Oct‑3/4 at approximately 50 kDa (as indicated) using 20 µg/mL of Goat Anti-Human/Mouse Oct‑3/4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1759) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(2 Reviews)
(33 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Osteopontin/OPN
Antibody [Unconjugate
AF808
Osteopontin/OPN was detected in immersion fixed C2C12 mouse myoblast cell line (left panel, positive stain) and mouse splenocytes (right panel, negative stain) using Goat Anti-Mouse Osteopontin/OPN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF808) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and secreted molecule. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Recombinant Mouse Osteopontin/OPN (Catalog # 441-OP), immobilized onto a microplate, supports the adhesion of the HEK293 human embryonic kidney cell line in a dose-dependent manner (orange line). Adhesion elicited by Recombinant Mouse Osteopontin/OPN (2 µg/mL) is neutralized (green line) by increasing concentrations of Mouse Osteopontin/OPN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF808). The ND50 is typically 1‑3 µg/mL.
Osteopontin/OPN was detected in perfusion fixed frozen sections of mouse thymus using Mouse Osteopontin/OPN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF808) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(8 Reviews)
(104 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
VASA Antibody
[Unconjugated]
AF2030
Western blot shows lysates of human testis tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human VASA Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2030) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for VASA at approximately 85 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
VASA was detected in paraffin-embedded sections of human testis using Goat Anti-Human VASA Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2030) at 10 µg/mL overnight at 4 °C. Before incubation with the primary antibody tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Reviews)
(24 Publications)
Species: Hu
Applications: IHC, WB
c-jun [p Ser63]
Antibody (SY0297)
NBP2-67471
Immunocytochemistry/Immunofluorescence: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Staining Phospho-c-Jun(S63) in A549 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Staining Phospho-c-Jun(S63) in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Analysis of paraffin-embedded human breast carcinoma tissue using anti-Phospho-c-Jun(S63) antibody. Counter stained with hematoxylin.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Calponin 2
Antibody (OTI2B5)
NBP2-01325
Western Blot: Calponin 2 Antibody (2B5) [NBP2-01325] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Calponin 2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Calponin 2.
Immunohistochemistry-Paraffin: Calponin 2 Antibody (2B5) [NBP2-01325] - Staining of paraffin-embedded Adenocarcinoma of Human breast tissue using anti-Calponin 2 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: Calponin 2 Antibody (2B5) [NBP2-01325] - Staining of paraffin-embedded Carcinoma of Human bladder tissue using anti-Calponin 2 mouse monoclonal antibody.
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
SEPHS1 Antibody
NBP1-32312
Immunocytochemistry/Immunofluorescence: SEPHS1 Antibody [NBP1-32312] - Analysis of HeLa, using Selenophosphate synthetase 1 antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: SEPHS1 Antibody [NBP1-32312] - Paraffin-embedded Colon Carcinoma; antibody dilution 1:500.
Western Blot: SEPHS1 Antibody [NBP1-32312] - Sample(30 ug of whole cell lysate)A:A431 B:MOLT4 12% SDS PAGE, antibody diluted at 1:500.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MxA/Mx1 Antibody
NBP1-32905
Immunohistochemistry-Paraffin: MxA/Mx1 Antibody [NBP1-32905] - Human lymph node. Antigen retrieval in citrate buffer, 95C for 30 min. Image submitted by a verified customer review.
Western Blot: MxA/Mx1 Antibody [NBP1-32905] - Whole cell extract (30 ug) was separated by 7.5% SDS-PAGE, and the membrane was blotted with MX1 antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: MxA/Mx1 Antibody [NBP1-32905] - A. 30 ug 293T whole cell lysate/extract B. 30 ug whole cell lysate/extract of human MX1-transfected 293T cells. 7.5 % SDS-PAGE MX1 antibody [N2C2], Internal dilution: 1:10000
(1 Review)
Species: Bv, Hu, Pm, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Viperin Antibody
NBP2-03971
Western Blot: Viperin Antibody [NBP2-03971] - Analysis of viperin using viperin polyclonal antibody. Human brain lysate in the absence (1) and presence (2) of immunizing peptide, mouse brain (3) and rat brain (4) lysate probed with viperin antibody at 3 ug/ml. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: Viperin Antibody [NBP2-03971] - Analysis of viperin using viperin polyclonal antibody. Human rectum tissue probed with viperin antibody at 5 ug/ml.
Species: Bv, Ca, Ch, ChHa, Eq, Hu, Mu, Po, Pm, Rb, Rt
Applications: IHC, IHC-P, WB
Recombinant Human
IFI6 GST (N-Term) Pro ...
H00002537-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB

PBEF/Visfatin/NAMPT An
NB100-594
Western Blot: PBEF/Visfatin/NAMPT Antibody [NB100-594] - Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-PBEF antibody used for IP at 6 ug per reaction. PBEF was also immunoprecipitated by a previous lot of this antibody and rabbit anti-Visfatin antibody. For blotting immunoprecipitated PBEF, Antibody was used at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Western Blot: PBEF/Visfatin/NAMPT Antibody [NB100-594] - Samples: Whole cell lysate (50 ug) from HeLa, RKO, MCF-7, TCMK-1, and NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-PBEF antibody used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunohistochemistry-Paraffin: PBEF/Visfatin/NAMPT Antibody [NB100-594] - Section of human head and neck squamous cell carcinoma. Antibody: Affinity purified rabbit anti-PBEF used at a dilution of 1:5,000 (0.2ug/ml). Detection: DAB
(9 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
p38 alpha Antibody
[Unconjugated]
AF8691
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and NIH‑3T3 mouse embryonic fibroblast cell line, loaded at 0.2 mg/mL. A specific band was detected for p38 alpha at approximately 43 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat p38 alpha Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8691). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HEK293T human embryonic kidney parental cell line and p38 alpha knockout HEK293T cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat p38 alpha Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8691) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for p38 alpha at approximately 38 kDa (as indicated) in the parental HEK293T cell line, but is not detectable in knockout HEK293T cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Orexin B, p38 alpha , and Integrin  beta 1 were detected in perfusion fixed frozen sections of mouse brainstem using Human Orexin B Monoclonal Antibody (red; Catalog # MAB734), Rabbit Anti-Human/Mouse/Rat p38 alpha Antigen Affinity-purified Polyclonal Antibody (green; Catalog # AF8691), and Mouse Integrin  beta 1 Antigen Affinity-purified Polyclonal Antibody (blue; Catalog # AF2405). Tissue was incubated with primary antibodies overnight at 4 °C. Tissue was stained using NorthernLights™ 493-conjugated Anti-Rabbit IgG Secondary Antibody (green; Catalog # NL006), NorthernLights 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007), and NorthernLights 637-conjugated Anti-Goat IgG Secondary Antibody (blue; Catalog # NL002). The image of Integrin beta 1 is pseudo-colored for presentation. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(3 Reviews)
(5 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Stella/Dppa3
Antibody [Unconjugate
AF2566
Stella/Dppa3 was detected in perfusion fixed frozen sections of mouse ovary tissue using Goat Anti-Mouse Stella/Dppa3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2566) at 1 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (brown; Catalog # VC004) and counterstained with hematoxylin (blue). Specific staining was localized to oocytes. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(1 Publication)
Species: Mu
Applications: IHC, WB
BLIMP1/PRDM1
Antibody (3H2-E8) - B ...
NB600-235
Immunocytochemistry/Immunofluorescence: BLIMP1/PRDM1 Antibody (3H2-E8) [NB600-235] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-BLIMP1/PRDM1 (3H2-E8) conjugated to DyLight 550 [NB600-235R] at 20ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow Cytometry: BLIMP1/PRDM1 Antibody (3H2-E8) [NB600-235] - Analysis using the Biotin conjugate of NB600-235. Staining of Blimp-1 in mouse spleen. Image courtesy of product review by Branislav Krljanac.
Immunocytochemistry/Immunofluorescence: BLIMP1/PRDM1 Antibody (3H2-E8) [NB600-235] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-BLIMP1 (3H2-E8) at 10 ug/ml overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(2 Reviews)
(50 Publications)
Species: Hu, Mu, Po
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Bcl-xL Antibody
NB100-56104
Western Blot: Bcl-xL Antibody [NB100-56104] - Analysis of Bcl-xL in Daoy whole cell lysate using anti-Bcl-xL antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: Bcl-xL Antibody [NB100-56104] - Analysis of Bcl-xL in human breast carcinoma at 1:2000. Formalin-fixed, paraffin-embedded tissue section from invasive ductal carcinoma. An organellar/mitochondrial pattern of Bcl-xL staining is observed in the cytosol of tumor cells.
Western Blot: Bcl-xL Antibody [NB100-56104] - Analysis of Bcl-xL in lysates from isolated rat liver mitochondria using this antibody. The antibody detected Bcl-xL at ~30 kDa.
(1 Review)
(2 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
BST2 Antibody
(120G8.04)
DDX0390P-100
Immunocytochemistry/Immunofluorescence: BST2 Antibody (120G8.04) [DDX0390P-100] - Murine peyer patch: BST-2
Immunohistochemistry: BST2 Antibody (120G8.04) [DDX0390P-100] - IHC staining of murine spleen cryosections
Flow Cytometry: BST2 Antibody (120G8.04) [DDX0390P-100] - Facs sorting of mouse PDCs (120G8/CD11c)
(63 Publications)
Species: Hu, Mu
Applications: B/N, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vivo
IRF1 Antibody
(SR44-08)
NBP2-67330
Flow Cytometry: IRF1 Antibody (SR44-08) [NBP2-67330] - Analysis of Jurkat cells with IRF1 antibody at 1/50 dilution (blue) compared with an unlabelled control (cells without incubation with primary antibody; red). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: IRF1 Antibody (SR44-08) [NBP2-67330] - Staining IRF1 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: IRF1 Antibody (SR44-08) [NBP2-67330] - Staining IRF1 in NIH/3T3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
MDA5 Antibody
NB110-1244
Immunohistochemistry-Paraffin: MDA5 Antibody [NB110-1244] - Staining in paraffin embedded Human Pancreas. Antibody at 10 ug/mL. Microwaved antigen retrieval with Tris/EDTA buffer pH 9, HRP-staining.
Flow Cytometry: MDA5 Antibody [NB110-1244] - Flow cytometric analysis of paraformaldehyde fixed K562 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (1ug/ml). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(8 Publications)
Species: Hu, Mu, Pm
Applications: Flow, IHC, IHC-P, PEP-ELISA

Publications for IFITM3/Fragilis Recombinant Protein (H00010410-P01)(1)


Reviews for IFITM3/Fragilis Recombinant Protein (H00010410-P01) (0)

There are no reviews for IFITM3/Fragilis Recombinant Protein (H00010410-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IFITM3/Fragilis Recombinant Protein (H00010410-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IFITM3/Fragilis Products

Bioinformatics Tool for IFITM3/Fragilis Recombinant Protein (H00010410-P01)

Discover related pathways, diseases and genes to IFITM3/Fragilis Recombinant Protein (H00010410-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFITM3/Fragilis Recombinant Protein (H00010410-P01)

Discover more about diseases related to IFITM3/Fragilis Recombinant Protein (H00010410-P01).
 

Pathways for IFITM3/Fragilis Recombinant Protein (H00010410-P01)

View related products by pathway.

PTMs for IFITM3/Fragilis Recombinant Protein (H00010410-P01)

Learn more about PTMs related to IFITM3/Fragilis Recombinant Protein (H00010410-P01).

Blogs on IFITM3/Fragilis

There are no specific blogs for IFITM3/Fragilis, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IFITM3/Fragilis GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol IFITM3