IFITM3/Fragilis Antibody - BSA Free

Western Blot: IFITM3/Fragilis Antibody [NBP3-10067] - Western blot analysis of IFITM3/Fragilis in Human Hela Whole Cell lysates. Antibody dilution at 1ug/ml

Product Discontinued

IFITM3/Fragilis Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IFITM3/Fragilis (NP_066362.2). Peptide sequence HTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSET
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IFITM3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 15 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for IFITM3/Fragilis Antibody - BSA Free

• 1-8U
• Fragilis
• IFITM3
• interferon induced transmembrane protein 3 (1-8U)
• interferon-induced transmembrane protein 3
• Interferon-inducible protein 1-8U
• IP15
• mil-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IFITM3