IFI44L Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: IFI44L Antibody [NBP2-58348] - Staining of human cell line PC-3 shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IFI44L Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SSVHGGSIEDMVERCSRQGCTITMAYIDYNMIVAFMLGNYINLHESSTEPNDSLWFSLQKKNDTTEIETLLLNTAP
Specificity
Specificity of human IFI44L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IFI44L
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for IFI44L Antibody

  • C1orf29
  • chromosome 1 open reading frame 29
  • GS3686
  • interferon-induced protein 44-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32905
Species: Hu, Bv, Mk, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-03971
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, ChHa, Eq, Pm, Rb
Applications: WB, IHC, IHC-P
NBP2-02340
Species: Hu, Mu, Rt, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP2-78460
Species: Hu
NBP2-78434
Species: Hu
NBP2-75930
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-58102
Species: Hu, Rt, Po, Bv, Eq, Rb
Applications: WB, ICC/IF, IHC
NBP1-52176
Species: Mu
Applications: Flow, ICC/IF, PEP-ELISA
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33675
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NB110-1244
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-87363
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89345
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-58887
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB
NBP2-58348
Species: Hu
Applications: ICC/IF

Publications for IFI44L Antibody (NBP2-58348) (0)

There are no publications for IFI44L Antibody (NBP2-58348).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFI44L Antibody (NBP2-58348) (0)

There are no reviews for IFI44L Antibody (NBP2-58348). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for IFI44L Antibody (NBP2-58348) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional IFI44L Products

Bioinformatics Tool for IFI44L Antibody (NBP2-58348)

Discover related pathways, diseases and genes to IFI44L Antibody (NBP2-58348). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFI44L Antibody (NBP2-58348)

Discover more about diseases related to IFI44L Antibody (NBP2-58348).
 

Pathways for IFI44L Antibody (NBP2-58348)

View related products by pathway.

PTMs for IFI44L Antibody (NBP2-58348)

Learn more about PTMs related to IFI44L Antibody (NBP2-58348).

Blogs on IFI44L

There are no specific blogs for IFI44L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFI44L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IFI44L