IFI44L Antibody - BSA Free

Western Blot: IFI44L Antibody [NBP1-57838] - Jurkat cell lysate, concentration 5.0ug/ml.

Immunohistochemistry-Paraffin: IFI44L Antibody [NBP1-57838] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Immunohistochemistry: IFI44L Antibody [NBP1-57838] - Overexpression of IFI44L gene inhibited the proliferation, migration, & invasion of NSCLC cells. (A, B) CCK-8 assay was used to detect the effect of IFI44L overexpression on NSCLC cell growth. (C–F) The cell migration was detected after overexpression of IFI44L gene by scratch healing tests. Bar equals 100 µm. (G–J) Overexpression of IFI44L inhibited the migration & invasion of NSCLC cells by transwell assay. Bar equals 50 µm. NSCLC, non-small cell lung cancer; CCK-8: cell counting kit-8; *p < 0.05, **p < 0.01, ***p < 0.001. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35047409), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Immunohistochemistry: IFI44L Antibody [NBP1-57838] - Verification of the prognostic value & immune implication of IFI44L in NSCLC. (A) Representative IHC images of IFI44L in TMA cohort with the scale bar equal to 50 µm. (B) The correlation of IFI44L expression with OS among 97 NSCLC patients. (C) Univariate Cox regression analysis regarding the expression of IFI44L & other clinical parameters. (D) Multivariate Cox regression analysis about the expression of IFI44L & clinical parameters. (E, F) The expression levels of the related immunomodulators were detected in NSCLC cells after overexpression of IFI44L. NSCLC, non-small cell lung cancer; OS, overall survival; LUAD, lung adenocarcinoma; IHC, immunohistochemistry; TMA, tissue microarray; **p < 0.01, ***p < 0.001. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35047409), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

IFI44L Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to IFI44L(interferon-induced protein 44-like) The peptide sequence was selected from the N terminal of IFI44L. Peptide sequence MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IFI44L
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for IFI44L Antibody - BSA Free

• C1orf29
• chromosome 1 open reading frame 29
• GS3686
• interferon-induced protein 44-like

Background

The function remains known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IFI44L Antibody (NBP1-57838)(1)

Publication using NBP1-57838

• Zeng Y, Zhang Z, Chen H et al. Comprehensive Analysis of Immune Implication and Prognostic Value of IFI44L in Non-Small Cell Lung Cancer Frontiers in oncology 2022-01-03 [PMID: 35047409] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: IFI44L
• Uniprot:
  • Q99984(Human)