Home » IFI16 » IFI16 Antibodies » IFI16 Antibody (4E6.)

IFI16 Antibody (4E6.)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: IFI16 Antibody (4E6) [H00003428-M04] - Analysis of IFI16 expression in Hela S3 NE (Cat # L013V3).
Western Blot: IFI16 Antibody (4E6) [H00003428-M04] - Analysis of IFI16 expression in Hela S3 NE (Cat # L013V3).
Immunohistochemistry-Paraffin: IFI16 Antibody (4E6) [H00003428-M04] - Analysis of monoclonal antibody to IFI16 on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 1.2 ug/ml
Sandwich ELISA: IFI16 Antibody (4E6) [H00003428-M04] - Detection limit for recombinant GST tagged IFI16 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
4E6.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

IFI16 Antibody (4E6.) Summary

Immunogen
IFI16 (AAH17059 630 a.a. - 729 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF
Specificity
IFI16 (4E6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IFI16
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA and IHC-P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IFI16 Antibody (4E6.)

  • ifi-16
  • IFNGIP1gamma-interferon-inducible protein 16
  • interferon, gamma-inducible protein 16
  • interferon-gamma induced protein IFI 16
  • Interferon-inducible myeloid differentiation transcriptional activator
  • MGC9466
  • PYHIN2

Background

This gene encodes a member of the HIN-200 (hematopoietic interferon-inducible nuclear antigens with 200 amino acid repeats) family of cytokines. The encoded protein contains domains involved in DNA binding, transcriptional regulation, and protein-protein interactions. The protein localizes to the nucleoplasm and nucleoli, and interacts with p53 and retinoblastoma-1. It modulates p53 function, and inhibits cell growth in the Ras/Raf signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

p21/CIP1/CDKN1A
Antibody (WA-1 (HJ21)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(11 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AIM2 Antibody
H00009447-B01P
Western Blot: AIM2 Antibody [H00009447-B01P] - Analysis of AIM2 expression in transfected 293T cell line by AIM2 polyclonal antibody. Lane 1: AIM2 transfected lysate(37.73 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: AIM2 Antibody [H00009447-B01P] - Analysis of purified antibody to AIM2 on HeLa cell. (antibody concentration 10 ug/ml)
(4 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF
IFN-gamma
[Unconjugated]
285-IF
1 μg/lane of Recombinant Human IFN-gamma was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is 0.15‑0.75 ng/mL.
(5 Reviews)
(245 Publications)
Species: Hu
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - WB analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(2 Reviews)
(22 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MNDA Antibody
(OTI4H6)
NBP2-45907
Western Blot: MNDA Antibody (4H6) [NBP2-45907] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY MNDA.
Immunohistochemistry: MNDA Antibody (4H6) [NBP2-45907] - Analysis of Human tonsil tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Immunohistochemistry: MNDA Antibody (4H6) [NBP2-45907] - Analysis of Adenocarcinoma of Human breast tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120°C for 3min)
Species: Hu
Applications: WB, IHC
Ifi204 Antibody
NBP2-27153
Western Blot: Ifi204 Antibody [NBP2-27153] - Analysis of Ifi204 in mouse heart tissue lysate in the 1) absence and 2) presence of immunizing peptide using this antibody. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: Ifi204 Antibody [NBP2-27153] - Analysis of Ifi204 in formalin-fixed, paraffin-embedded mouse testis tissue using this antibody at 5 ug/ml.
Species: Mu
Applications: WB, IHC-P
53BP1 Antibody
NB100-304
Western Blot: 53BP1 Antibody [NB100-304] - Total protein from HeLa, A431, Neuro2A, and PC12 was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-53BP1 in 5% block buffer and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Frozen: 53BP1 Antibody [NB100-304] - Irradiated cochlear spiral ganglion cells, mouse, frozen section of fixed material. Data and image from confirmed customer review.
Immunocytochemistry/Immunofluorescence: 53BP1 Antibody [NB100-304] - 53BP1 foci in proliferating MEFs; both normal and exposed to 10 Gy of IR.
(8 Reviews)
(296 Publications)
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, KO
PAK3 [p Ser144, p
Ser141, p Ser139] Ant ...
NBP2-67484
Western Blot: PAK3 [p Ser144, p Ser141, p Ser139] Antibody (SU03-70) [NBP2-67484] - Analysis of Phospho- PAK1(S144)+PAK2(S141)+PAK3(S139) on different lysates using anti-Phospho- PAK1(S144)+PAK2(S141)+PAK3(S139) antibody at 1/1,000 dilution. Positive control: Lane 1: Hela Lane 2: NIH/3T3 Lane 3: SH-SY-5Y
Immunocytochemistry/Immunofluorescence: PAK3 [p Ser144, p Ser141, p Ser139] Antibody (SU03-70) [NBP2-67484] - Staining Phospho- PAK1(S144)+PAK2(S141)+PAK3(S139) in NIH/3T3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: PAK3 [p Ser144, p Ser141, p Ser139] Antibody (SU03-70) [NBP2-67484] - Analysis of paraffin-embedded mouse brain tissue using anti- Phospho- PAK1(S144)+PAK2(S141)+PAK3(S139) antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
cleaved
Retinoblastoma 1 Anti ...
NB100-56598
Western Blot: cleaved Retinoblastoma 1 Antibody (172C1094) [NB100-56598] - Analysis in HL60 cells were treated with camptothecin for 24 hours.
Immunohistochemistry: cleaved Retinoblastoma 1 Antibody (172C1094) [NB100-56598] - Analysis in sections of primary human breast tumors. Image courtesy of Dr. Macleod, The Ben May Institute for Cancer Research, and The University of Chicago.
(2 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
PYHIN1 Antibody
NBP2-13835
Western Blot: PYHIN1 Antibody [NBP2-13835] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: PYHIN1 Antibody [NBP2-13835] - Staining of human skin shows low expression as expected.
Immunohistochemistry-Paraffin: PYHIN1 Antibody [NBP2-13835] - Staining of human tonsil shows moderate nuclear positivity in both germinal center cells and non-germinal center cells.
Species: Hu
Applications: WB, IHC, IHC-P
Recombinant Human
Interferon alpha Prot ...
NBP2-26551
Recombinant Human Interferon alpha Protein
(1 Publication)
Species: Hu
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Western Blot: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY TCEAL1.
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human lymphoma tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)(
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human Ovary tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Species: Hu
Applications: WB, IHC
D4S234E Antibody
(1C3)
H00027065-M01
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3 Analysis of D4S234E expression in IMR-32.
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3. Analysis of D4S234E expression in PC-12.
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3. Analysis of D4S234E expression in rat brain.
(1 Publication)
Species: Hu, Rt
Applications: WB, ELISA
IFI202b Antibody
NBP2-27066
Western Blot: IFI202b Antibody [NBP2-27066] - Analysis of Ifi202b in mouse spleen tissue lysate in the 1) absence and 2) presence of immunizing peptide, and 3) NIH 3T3 cell lysate using this antibody. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
(3 Publications)
Species: Mu
Applications: WB
ID1 Antibody
(JM92-13)
NBP2-66897
Western Blot: ID1 Antibody (JM92-13) [NBP2-66897] - Analysis of Id1 on 293T cell using anti-Id1 antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: ID1 Antibody (JM92-13) [NBP2-66897] - Staining Id1 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: ID1 Antibody (JM92-13) [NBP2-66897] - Analysis of paraffin-embedded human tonsil tissue using anti-Id1 antibody. Counter stained with hematoxylin.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
c-Myc Antibody
NB600-335
Western Blot: c-Myc Antibody [NB600-335] - Detection of c-myc-tagged Protein by Western Blot. Samples: 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibodies: Affinity purified, goat anti-c-myc antibody NB600-335 used for WB at 0.04 ug/ml (1:25,000). Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunocytochemistry/Immunofluorescence: c-Myc Antibody [NB600-335] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-c-Myc conjugated to Alexa Fluor 488 [NB600-335AF488] at 10ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective. Image from the Alexa Fluor 488 version of this antibody.
Western Blot: c-Myc Antibody [NB600-335] - Analysis using the HRP conjugate of NB600-335. Detection of 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibody used for WB at 0.4 ug/ml (1:25,000).
(1 Review)
(38 Publications)
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
IL-3 [Unconjugated]
203-IL/CF
1 μg/lane of Recombinant Human IL-3 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 14 kDa.
Recombinant Human IL-3 (Catalog #203‑IL/CF) stimulates cell proliferation of the TF-1 human erythroleukemic cell line. The ED50 for this effect is 0.02‑0.1 ng/mL.
(112 Publications)
Species: Hu
IFI16 Antibody
(4E6.)
H00003428-M04
IFI16 Antibody (4E6.)
Species: Hu
Applications: WB, ELISA, IHC-P

Publications for IFI16 Antibody (H00003428-M04) (0)

There are no publications for IFI16 Antibody (H00003428-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFI16 Antibody (H00003428-M04) (0)

There are no reviews for IFI16 Antibody (H00003428-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IFI16 Antibody (H00003428-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IFI16 Products

Bioinformatics Tool for IFI16 Antibody (H00003428-M04)

Discover related pathways, diseases and genes to IFI16 Antibody (H00003428-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFI16 Antibody (H00003428-M04)

Discover more about diseases related to IFI16 Antibody (H00003428-M04).
 

Pathways for IFI16 Antibody (H00003428-M04)

View related products by pathway.

PTMs for IFI16 Antibody (H00003428-M04)

Learn more about PTMs related to IFI16 Antibody (H00003428-M04).
 

Research Areas for IFI16 Antibody (H00003428-M04)

Find related products by research area.

Blogs on IFI16.

Check out the latest blog posts on IFI16.
STING in Innate Immunity and Cancer: What’s the Buzz About?
STING (STimulator of INterferon Genes protein) acts as a sensor of cytosolic DNA. Bacteria/Virus or self-derived DNA in the cytosol activates the STING pathway and promotes the production of type I interferons (IFN-alpha and IFN-beta). STING also...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFI16 Antibody (4E6.) and receive a gift card or discount.


Bioinformatics

Gene Symbol IFI16
Entrez
OMIM
Uniprot