IFI16 Antibody (4E6.)

Images

 
Western Blot: IFI16 Antibody (4E6) [H00003428-M04] - Analysis of IFI16 expression in Hela S3 NE (Cat # L013V3).
Immunohistochemistry-Paraffin: IFI16 Antibody (4E6) [H00003428-M04] - Analysis of monoclonal antibody to IFI16 on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 1.2 ug/ml
Sandwich ELISA: IFI16 Antibody (4E6) [H00003428-M04] - Detection limit for recombinant GST tagged IFI16 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
4E6.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IFI16 Antibody (4E6.) Summary

Immunogen
IFI16 (AAH17059 630 a.a. - 729 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF
Specificity
IFI16 (4E6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IFI16
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA and IHC-P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IFI16 Antibody (4E6.)

  • ifi-16
  • IFNGIP1gamma-interferon-inducible protein 16
  • interferon, gamma-inducible protein 16
  • interferon-gamma induced protein IFI 16
  • Interferon-inducible myeloid differentiation transcriptional activator
  • MGC9466
  • PYHIN2

Background

This gene encodes a member of the HIN-200 (hematopoietic interferon-inducible nuclear antigens with 200 amino acid repeats) family of cytokines. The encoded protein contains domains involved in DNA binding, transcriptional regulation, and protein-protein interactions. The protein localizes to the nucleoplasm and nucleoli, and interacts with p53 and retinoblastoma-1. It modulates p53 function, and inhibits cell growth in the Ras/Raf signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00009447-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-45907
Species: Hu
Applications: WB, IHC
NBP2-27153
Species: Mu
Applications: WB, IHC-P
NB100-304
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
AF6897
Species: Hu, Mu
Applications: WB, IHC
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-13835
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27066
Species: Mu
Applications: WB
AF4377
Species: Hu, Mu
Applications: WB, ICC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
H00003428-M04
Species: Hu
Applications: WB, ELISA, IHC-P

Publications for IFI16 Antibody (H00003428-M04) (0)

There are no publications for IFI16 Antibody (H00003428-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFI16 Antibody (H00003428-M04) (0)

There are no reviews for IFI16 Antibody (H00003428-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IFI16 Antibody (H00003428-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IFI16 Products

Bioinformatics Tool for IFI16 Antibody (H00003428-M04)

Discover related pathways, diseases and genes to IFI16 Antibody (H00003428-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFI16 Antibody (H00003428-M04)

Discover more about diseases related to IFI16 Antibody (H00003428-M04).
 

Pathways for IFI16 Antibody (H00003428-M04)

View related products by pathway.

PTMs for IFI16 Antibody (H00003428-M04)

Learn more about PTMs related to IFI16 Antibody (H00003428-M04).
 

Research Areas for IFI16 Antibody (H00003428-M04)

Find related products by research area.

Blogs on IFI16.

STING in Innate Immunity and Cancer: What’s the Buzz About?
STING (STimulator of INterferon Genes protein) acts as a sensor of cytosolic DNA. Bacteria/Virus or self-derived DNA in the cytosol activates the STING pathway and promotes the production of type I interferons (IFN-alpha and IFN-beta). STING also...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFI16 Antibody (4E6.) and receive a gift card or discount.

Bioinformatics

Gene Symbol IFI16
Entrez
OMIM
Uniprot