IF3EI Recombinant Protein Antigen

Images

 
There are currently no images for IF3EI Protein (NBP1-87955PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IF3EI Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EIF3L.

Source: E.coli

Amino Acid Sequence: RMQKGDPQVYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKVFSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGISALDGEFQSASEVDFYIDKDMIHIADTKVAR

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EIF3L
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-87955.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for IF3EI Recombinant Protein Antigen

  • eIEF associated protein HSPC021
  • EIF3EIP
  • eIF3l
  • EIF3S11
  • EIF3S6IP
  • Eukaryotic translation initiation factor 3 subunit 6-interacting protein
  • Eukaryotic translation initiation factor 3 subunit E-interacting protein
  • eukaryotic translation initiation factor 3 subunit L
  • eukaryotic translation initiation factor 3, subunit 6 interacting protein
  • eukaryotic translation initiation factor 3, subunit L
  • HSPC021
  • HSPC025
  • MSTP005
  • subunit E interacting protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84869
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
H00010920-B01P
Species: Hu, Rt
Applications: WB, ICC/IF
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16299
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, ChIP
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-56599
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC
NBP1-84870
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24571
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB120-495
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00002189-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NB100-563
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-85302
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP1-87955PEP
Species: Hu
Applications: AC

Publications for IF3EI Protein (NBP1-87955PEP) (0)

There are no publications for IF3EI Protein (NBP1-87955PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IF3EI Protein (NBP1-87955PEP) (0)

There are no reviews for IF3EI Protein (NBP1-87955PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IF3EI Protein (NBP1-87955PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional IF3EI Products

Bioinformatics Tool for IF3EI Protein (NBP1-87955PEP)

Discover related pathways, diseases and genes to IF3EI Protein (NBP1-87955PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IF3EI Protein (NBP1-87955PEP)

Discover more about diseases related to IF3EI Protein (NBP1-87955PEP).
 

Pathways for IF3EI Protein (NBP1-87955PEP)

View related products by pathway.

PTMs for IF3EI Protein (NBP1-87955PEP)

Learn more about PTMs related to IF3EI Protein (NBP1-87955PEP).
 

Research Areas for IF3EI Protein (NBP1-87955PEP)

Find related products by research area.

Blogs on IF3EI

There are no specific blogs for IF3EI, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IF3EI Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF3L