IDH3B Antibody (3A10)

Product Discontinued

IDH3B Antibody (3A10) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: IDH3B (NP_008830, 296 a.a. ~ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKG
• Specificity: IDH3B - isocitrate dehydrogenase 3 (NAD+) beta
• Isotype: IgG3 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: IDH3B
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
• Application Notes: Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IDH3B Antibody (3A10)

• EC 1.1.1
• EC 1.1.1.41
• FLJ11043
• H-IDHB
• isocitrate dehydrogenase [NAD] subunit beta, mitochondrial
• isocitrate dehydrogenase 3 (NAD+) beta
• isocitrate dehydrogenase, NAD(+)-specific, mitochondrial, beta subunit
• Isocitric dehydrogenase subunit beta
• MGC903
• NAD(+)-specific ICDH subunit beta
• NAD+-specific ICDH
• NAD+-specific isocitrate dehydrogenase b subunit
• NAD+-specific isocitrate dehydrogenase beta
• RP46

Background

Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the beta subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. Three alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IDH3B Antibody (H00003420-M01)(1)

Publication using H00003420-M01

• Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018-01-01

Bioinformatics

• Gene Symbol: IDH3B
• Entrez:
  • 3420(Human)
• OMIM:
  • 604526(Human)
• Uniprot:
  • NP_008830(Human)