ID2 Antibody

Images

 
Western Blot: ID2 Antibody [H00003398-D03P] - Analysis of ID2 expression in transfected 293T cell line by ID2 polyclonal antibody.Lane 1: ID2 transfected lysate(14.85 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ID2 Antibody Summary

Immunogen
ID2 (AAH30639, 1 a.a. - 134 a.a.) full-length human protein. MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG
Specificity
ID2 - inhibitor of DNA binding 2, dominant negative helix-loop-helix protein,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ID2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against transfected lysate for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ID2 Antibody

  • BHLHB26
  • bHLHb26cell growth-inhibiting gene 8
  • Class B basic helix-loop-helix protein 26
  • DNA-binding protein inhibitor ID2
  • DNA-binding protein inhibitor ID-2
  • GIG8
  • helix-loop-helix protein ID2
  • ID2
  • ID2A
  • ID2H
  • inhibitor of differentiation 2
  • Inhibitor of DNA binding 2
  • inhibitor of DNA binding 2, dominant negative helix-loop-helix protein
  • MGC26389

Background

The protein encoded by this gene belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene has been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4377
Species: Hu, Mu
Applications: WB, ICC
NBP2-02136
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB7650
Species: Mu
Applications: WB, IHC
H00003400-B01P
Species: Hu
Applications: WB, ICC/IF
AF6116
Species: Hu
Applications: WB, ICC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ID2 Antibody (H00003398-D03P) (0)

There are no publications for ID2 Antibody (H00003398-D03P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ID2 Antibody (H00003398-D03P) (0)

There are no reviews for ID2 Antibody (H00003398-D03P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ID2 Antibody (H00003398-D03P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ID2 Products

Bioinformatics Tool for ID2 Antibody (H00003398-D03P)

Discover related pathways, diseases and genes to ID2 Antibody (H00003398-D03P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ID2 Antibody (H00003398-D03P)

Discover more about diseases related to ID2 Antibody (H00003398-D03P).
 

Pathways for ID2 Antibody (H00003398-D03P)

View related products by pathway.

PTMs for ID2 Antibody (H00003398-D03P)

Learn more about PTMs related to ID2 Antibody (H00003398-D03P).
 

Research Areas for ID2 Antibody (H00003398-D03P)

Find related products by research area.

Blogs on ID2

There are no specific blogs for ID2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ID2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ID2
Entrez
Uniprot