ID1 Antibody

Western Blot: ID1 Antibody [H00003397-B01P] - Analysis of ID1 expression in transfected 293T cell line by ID1 polyclonal antibody. Lane 1: ID1 transfected lysate(17.05 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: ID1 Antibody [H00003397-B01P] - Analysis of purified antibody to ID1 on HeLa cell. (antibody concentration 10 ug/ml)

Product Discontinued

ID1 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: ID1 (NP_002156.2, 1 a.a. - 155 a.a.) full-length human protein. MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
• Specificity: ID1 - inhibitor of DNA binding 1, dominant negative helix-loop-helix protein,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: ID1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IF.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ID1 Antibody

• BHLHB24
• bHLHb24DNA-binding protein inhibitor ID-1
• Class B basic helix-loop-helix protein 24
• dJ857M17.1.2 (inhibitor of DNA binding 1, dominant negative helix-loop-helixprotein)
• dJ857M17.1.2
• ID
• ID1
• inhibitor of differentiation 1
• Inhibitor of DNA binding 1
• inhibitor of DNA binding 1, dominant negative helix-loop-helix protein

Background

The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and transcriptional activation ability of basic HLH proteins with which it interacts. This protein may play a role in cell growth, senescence, and differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ID1
• Entrez:
  • 3397(Human)
• Uniprot:
  • NP_002156.2(Human)